DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6923 and AT2G29840

DIOPT Version :9

Sequence 1:NP_001262484.1 Gene:CG6923 / 41420 FlyBaseID:FBgn0037944 Length:1265 Species:Drosophila melanogaster
Sequence 2:NP_180545.2 Gene:AT2G29840 / 817534 AraportID:AT2G29840 Length:293 Species:Arabidopsis thaliana


Alignment Length:144 Identity:38/144 - (26%)
Similarity:58/144 - (40%) Gaps:28/144 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly  1098 QQQPQ---AQQSPPVMQHMQRQRAIHH------HMFHHH----YSPLHLEIGLAPLSLGSRILIA 1149
            :|.|.   .|.||     .|.|..:.|      |.|.|.    :.|...::..|..   :....|
plant   157 EQDPNVFYGQSSP-----YQPQEVLFHWLPRYEHDFDHQTEEAFHPQFEQVLQASF---NETNTA 213

  Fly  1150 PSRPNRGATLETIERNTLPHKYRRVRRPSETDEDAEKCAICLNLFEIENEVRRLPCMHLFHTDCV 1214
            ..:|.....:|::.|.|       .::.|:...:.|.|:|||..|:....:..|||.|.|..:|.
plant   214 RLKPASKLAVESLNRKT-------YKKASDVVGENEMCSICLEEFDDGRSIVALPCGHEFDDECA 271

  Fly  1215 DQWLVTNKHCPICR 1228
            .:|..||..||:||
plant   272 LKWFETNHDCPLCR 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6923NP_001262484.1 zf-rbx1 <1185..1228 CDD:289448 17/42 (40%)
zf-RING_2 1187..1228 CDD:290367 16/40 (40%)
AT2G29840NP_180545.2 zf-RING_2 242..285 CDD:290367 17/42 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1249953at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.