DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6923 and RNF128

DIOPT Version :9

Sequence 1:NP_001262484.1 Gene:CG6923 / 41420 FlyBaseID:FBgn0037944 Length:1265 Species:Drosophila melanogaster
Sequence 2:NP_919445.1 Gene:RNF128 / 79589 HGNCID:21153 Length:428 Species:Homo sapiens


Alignment Length:418 Identity:84/418 - (20%)
Similarity:146/418 - (34%) Gaps:128/418 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   895 PPAPGVASN-----ANLAA-----AVSPPPP--------LEMYSGRS-TIPHCGSPPFSVRRSEA 940
            ||..||:..     :.|.|     |:||..|        ...|...| .:||.|     |.|:..
Human     4 PPGAGVSCRGGCGFSRLLAWCFLLALSPQAPGSRGAEAVWTAYLNVSWRVPHTG-----VNRTVW 63

  Fly   941 AYSNRQHYQPQPHQGHQAPQNQMHAHIHPPHRASAIVATSLTPAPPYPVHQNLWYRQQSMQEMHR 1005
            ..|....|      |..:|...:...:.||....|:.|.:                      .|.
Human    64 ELSEEGVY------GQDSPLEPVAGVLVPPDGPGALNACN----------------------PHT 100

  Fly  1006 RHMTPTPIDLSSNAPLLTSTLRNGYLHSICSCVHARNGPVSSLDPAYYPPYDAAPAAAAPPPSPQ 1070
            ....||         :..||::..:|..|     .|.|..:..|..:. .|:...:.|.....| 
Human   101 NFTVPT---------VWGSTVQVSWLALI-----QRGGGCTFADKIHL-AYERGASGAVIFNFP- 149

  Fly  1071 QQSPATSGSGNSSVAAQASMRHLQLQPQQQPQA----------QQSPPVMQHMQRQRAI------ 1119
                   |:.|..:            |...|.|          .:...::|.:||...:      
Human   150 -------GTRNEVI------------PMSHPGAVDIVAIMIGNLKGTKILQSIQRGIQVTMVIEV 195

  Fly  1120 --HHHMFHHHYSPLHLEIG---LAPLSLGSRILIAPSRPNRGATLETIERNTLPHKYRRV----- 1174
              .|..:.:|||...:.:.   :...::|..|..: :|..|.|..::.::..|....::.     
Human   196 GKKHGPWVNHYSIFFVSVSFFIITAATVGYFIFYS-ARRLRNARAQSRKQRQLKADAKKAIGRLQ 259

  Fly  1175 -----RRPSETDEDAEKCAICLNLFEIENEVRRLPCMHLFHTDCVDQWLVTNKHCPICRVD---- 1230
                 :...|...|.:.||:|:.|::..:.||.|.|.|:||..|||.||:.::.||:|:.|    
Human   260 LRTLKQGDKEIGPDGDSCAVCIELYKPNDLVRILTCNHIFHKTCVDPWLLEHRTCPMCKCDILKA 324

  Fly  1231 --IETHMPNDALP---PSSSGVPDAANS 1253
              ||..:.:.::.   |.|:.:.::|:|
Human   325 LGIEVDVEDGSVSLQVPVSNEISNSASS 352

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6923NP_001262484.1 zf-rbx1 <1185..1228 CDD:289448 18/42 (43%)
zf-RING_2 1187..1228 CDD:290367 18/40 (45%)
RNF128NP_919445.1 PA_GRAIL_like 48..193 CDD:239037 35/212 (17%)
RING-H2_RNF128_like 275..323 CDD:319716 20/47 (43%)
RING-H2 finger (C3H2C3-type) 277..317 CDD:319716 18/39 (46%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 346..428 2/7 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D442767at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.