DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6923 and rnf115a

DIOPT Version :9

Sequence 1:NP_001262484.1 Gene:CG6923 / 41420 FlyBaseID:FBgn0037944 Length:1265 Species:Drosophila melanogaster
Sequence 2:NP_001073542.1 Gene:rnf115a / 790928 ZFINID:ZDB-GENE-061215-82 Length:310 Species:Danio rerio


Alignment Length:104 Identity:29/104 - (27%)
Similarity:47/104 - (45%) Gaps:16/104 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly  1150 PSRPNRGATLETIERNTLPHKYRRVRRPSETDEDAEKCAICLNLFEIENEVRRLPCMHLFHTDCV 1214
            |:...:.::|.|:           :.....||.:.| |.:|...:.:...||:|||.|.||:||:
Zfish   213 PAEKEKISSLPTV-----------IITQEHTDCNME-CPVCKEDYTVGEPVRQLPCNHFFHSDCI 265

  Fly  1215 DQWLVTNKHCPICRVDIETHMPNDALPPSSSGVPDAANS 1253
            ..||..:..||:||..:.    .|.....||..|.:.|:
Zfish   266 VPWLELHDTCPVCRKSLN----GDESGTQSSSEPSSLNT 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6923NP_001262484.1 zf-rbx1 <1185..1228 CDD:289448 17/42 (40%)
zf-RING_2 1187..1228 CDD:290367 16/40 (40%)
rnf115aNP_001073542.1 zinc_ribbon_9 11..41 CDD:291067
zf-RING_2 237..279 CDD:290367 17/42 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1249953at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.