powered by:
Protein Alignment CG6923 and Rnf148
DIOPT Version :9
Sequence 1: | NP_001262484.1 |
Gene: | CG6923 / 41420 |
FlyBaseID: | FBgn0037944 |
Length: | 1265 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_082030.1 |
Gene: | Rnf148 / 71300 |
MGIID: | 1918550 |
Length: | 316 |
Species: | Mus musculus |
Alignment Length: | 53 |
Identity: | 19/53 - (35%) |
Similarity: | 35/53 - (66%) |
Gaps: | 0/53 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 1179 ETDEDAEKCAICLNLFEIENEVRRLPCMHLFHTDCVDQWLVTNKHCPICRVDI 1231
|.|.:.:.|.:|.::::.::.:|.|.|.|.||..|:|.||:.::.||:|:.||
Mouse 261 ELDPNEDSCVVCFDMYKAQDVIRILTCKHFFHKTCIDPWLLAHRTCPMCKCDI 313
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D442767at33208 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
1 |
1.030 |
- |
avgDist |
Average_Evolutionary_Distance |
R1977 |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
3 | 2.950 |
|
Return to query results.
Submit another query.