DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6923 and Rnf148

DIOPT Version :9

Sequence 1:NP_001262484.1 Gene:CG6923 / 41420 FlyBaseID:FBgn0037944 Length:1265 Species:Drosophila melanogaster
Sequence 2:NP_082030.1 Gene:Rnf148 / 71300 MGIID:1918550 Length:316 Species:Mus musculus


Alignment Length:53 Identity:19/53 - (35%)
Similarity:35/53 - (66%) Gaps:0/53 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly  1179 ETDEDAEKCAICLNLFEIENEVRRLPCMHLFHTDCVDQWLVTNKHCPICRVDI 1231
            |.|.:.:.|.:|.::::.::.:|.|.|.|.||..|:|.||:.::.||:|:.||
Mouse   261 ELDPNEDSCVVCFDMYKAQDVIRILTCKHFFHKTCIDPWLLAHRTCPMCKCDI 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6923NP_001262484.1 zf-rbx1 <1185..1228 CDD:289448 14/42 (33%)
zf-RING_2 1187..1228 CDD:290367 14/40 (35%)
Rnf148NP_082030.1 PA_GRAIL_like 56..190 CDD:239037
zf-RING_2 267..310 CDD:290367 14/42 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D442767at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1977
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.950

Return to query results.
Submit another query.