DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6923 and Rnf126

DIOPT Version :9

Sequence 1:NP_001262484.1 Gene:CG6923 / 41420 FlyBaseID:FBgn0037944 Length:1265 Species:Drosophila melanogaster
Sequence 2:NP_653111.1 Gene:Rnf126 / 70294 MGIID:1917544 Length:313 Species:Mus musculus


Alignment Length:189 Identity:48/189 - (25%)
Similarity:81/189 - (42%) Gaps:27/189 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly  1087 QASMRHLQLQPQQQPQAQQSPPVMQHMQRQRAIHHHMFHHHYSPLHL-EIGLAPLSLGSRILIAP 1150
            |:..|:...||:.:..|:::....:.:.....|...:.:...||..: .:||.|..      :..
Mouse   117 QSRHRYGARQPRARLTARRATGRHEGVPTLEGIIQQLVNGIISPAAVPSLGLGPWG------VLH 175

  Fly  1151 SRPNR---GAT-LETI-------ERNTLP-----HKYRRVRRPSETDE---DAEKCAICLNLFEI 1196
            |.|..   ||. |:||       ..||.|     .|.:.:.....|:|   ...:|.:|...:.:
Mouse   176 SNPMDYAWGANGLDTIITQLLNQFENTGPPPADKEKIQALPTVPVTEEHVGSGLECPVCKEDYAL 240

  Fly  1197 ENEVRRLPCMHLFHTDCVDQWLVTNKHCPICRVDIETHMPNDALPPSSSGVPDAANSAA 1255
            ...||:|||.||||..|:..||..:..||:||..: |.......||..:||..:::|::
Mouse   241 GESVRQLPCNHLFHDSCIVPWLEQHDSCPVCRKSL-TGQNTATNPPGLTGVGFSSSSSS 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6923NP_001262484.1 zf-rbx1 <1185..1228 CDD:289448 16/42 (38%)
zf-RING_2 1187..1228 CDD:290367 16/40 (40%)
Rnf126NP_653111.1 Required for interaction with BAG6. /evidence=ECO:0000250|UniProtKB:Q9BV68 5..100
zinc_ribbon_9 10..40 CDD:373030
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 42..63
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 95..128 3/10 (30%)
Sufficient for interaction with AICDA. /evidence=ECO:0000250|UniProtKB:Q9BV68 202..306 29/98 (30%)
RING-H2_RNF126 230..273 CDD:319715 17/42 (40%)
RING-H2 finger (C3H2C3-type) 231..271 CDD:319715 16/39 (41%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 279..313 5/20 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1249953at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.