DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6923 and rnf165a

DIOPT Version :9

Sequence 1:NP_001262484.1 Gene:CG6923 / 41420 FlyBaseID:FBgn0037944 Length:1265 Species:Drosophila melanogaster
Sequence 2:XP_017208346.1 Gene:rnf165a / 572251 ZFINID:ZDB-GENE-091118-64 Length:321 Species:Danio rerio


Alignment Length:397 Identity:114/397 - (28%)
Similarity:158/397 - (39%) Gaps:143/397 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   875 NRTPPHTMVHAQHQQRQSINPPAPGVASNANLAAAVSPPPPLEMYSGRSTIPHCGSPPFSVRRSE 939
            :||..|   .::||...:.:.....:|:.|....|..|||||             :||       
Zfish    28 SRTGAH---FSRHQHSHATSCRHFHLAATATPLPADFPPPPL-------------APP------- 69

  Fly   940 AAYSNRQHYQPQPHQGHQAPQNQMHAHIHPPHRASAIVATSLTPAPPYPVHQNLWYRQQSMQEMH 1004
                   .||..|                ||....|:       ...|.:.|.|..|:::.:.: 
Zfish    70 -------QYQEVP----------------PPFLPQAL-------QQQYLIQQQLLQRRRTQERV- 103

  Fly  1005 RRHMTPTPIDLSSNAPLLTSTLRNGYLHSICSCVHARNGPVSSLDPAYYPPYDAAPAAAAPPPSP 1069
                           ||.|..||                          |.|:.||....|.|.|
Zfish   104 ---------------PLNTHRLR--------------------------PGYEYAPPLHVPQPIP 127

  Fly  1070 QQQSPATSGSGNSSVAAQASMRHLQLQPQQQPQAQQ---SPPVMQHMQRQ----RAIHHHMFHHH 1127
            ||......|: :..::..|.:.| |...||.||..|   :.|.|.|:.|.    :.:.|.:.::.
Zfish   128 QQPRYLAEGT-DWDLSVDAGVLH-QYPLQQIPQPYQHYLASPRMHHLPRNTSTTQVVVHEIRNYP 190

  Fly  1128 YSPLHLEIGLAPLSLGSRILIAPSR---------------------PNRGATLETIERNTLPHKY 1171
            |..|||      |:|.|   ::|||                     .:|||...||||.|.||||
Zfish   191 YPQLHL------LALQS---LSPSRHSSAVRESYEELLQLEDRLGSVSRGAIQTTIERFTFPHKY 246

  Fly  1172 RRVRRP-----SETDEDA---EKCAICLNLFEIENEVRRLPCMHLFHTDCVDQWLVTNKHCPICR 1228
            :: |:|     .|.||::   |||.|||::.|...:|||||||||||..||||||.|::.|||||
Zfish   247 KK-RKPLDLKFCENDEESDVDEKCTICLSMLEDGEDVRRLPCMHLFHQACVDQWLATSRKCPICR 310

  Fly  1229 VDIETHM 1235
            |||:|.:
Zfish   311 VDIQTQL 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6923NP_001262484.1 zf-rbx1 <1185..1228 CDD:289448 28/42 (67%)
zf-RING_2 1187..1228 CDD:290367 26/40 (65%)
rnf165aXP_017208346.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170574553
Domainoid 1 1.000 79 1.000 Domainoid score I8608
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003192
OrthoInspector 1 1.000 - - otm25205
orthoMCL 1 0.900 - - OOG6_110422
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1977
SonicParanoid 1 1.000 - - X3096
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
76.860

Return to query results.
Submit another query.