DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6923 and rnf115b

DIOPT Version :9

Sequence 1:NP_001262484.1 Gene:CG6923 / 41420 FlyBaseID:FBgn0037944 Length:1265 Species:Drosophila melanogaster
Sequence 2:XP_003200594.1 Gene:rnf115b / 563879 ZFINID:ZDB-GENE-060503-608 Length:301 Species:Danio rerio


Alignment Length:254 Identity:62/254 - (24%)
Similarity:96/254 - (37%) Gaps:53/254 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly  1020 PLLTSTLRNGYLHSICSCVHARNGPVSSLDPAYYPPYD--AAPAAAAPPPS----PQQQSPATSG 1078
            |.:|..||:                 |.|.||...|..  |.|.|:....|    |||.||.|:.
Zfish    84 PSVTDALRS-----------------SGLQPAVADPASGTAGPVASVESLSDCTEPQQNSPQTNS 131

  Fly  1079 SGNSSVAAQASMRHLQLQPQQQPQAQQSPPVMQHMQRQRAIHHHMFHHHYSPLHLEIGLAPLSLG 1143
            ..:...|.:..::  |........:..:.|  |......|:|.:...:.:....|:..:..| ||
Zfish   132 RQDQGQAVEGIVQ--QFLAGLFSNSDSAGP--QTSSWSSALHSNPGDYAWGQGGLDAVVTQL-LG 191

  Fly  1144 SRILIAPSRPNRG---ATLETIERNTLPHKYRRVRRPSETDEDAEKCAICLNLFEIENEVRRLPC 1205
                   ...|.|   |..|.|  ::||    .|...||......:|.:|...|.:...||:|||
Zfish   192 -------QSENSGPPPAEKEMI--SSLP----TVSISSEQAACRLECPVCREEFSVGESVRQLPC 243

  Fly  1206 MHLFHTDCVDQWLVTNKHCPICRVDIETH--------MPNDALPPSSSGVPDAANSAAL 1256
            :|.||:.|:..||..:..||:||..::..        .|.:.: ||...:|:.:....|
Zfish   244 LHYFHSSCIVPWLQLHDTCPVCRKSLDGEDRGFQPRPDPQETI-PSPPDLPERSTFETL 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6923NP_001262484.1 zf-rbx1 <1185..1228 CDD:289448 16/42 (38%)
zf-RING_2 1187..1228 CDD:290367 16/40 (40%)
rnf115bXP_003200594.1 zinc_ribbon_9 11..41 CDD:291067
zf-RING_2 224..266 CDD:290367 16/41 (39%)
RING <250..288 CDD:302633 8/38 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1249953at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.