DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6923 and znrf3

DIOPT Version :9

Sequence 1:NP_001262484.1 Gene:CG6923 / 41420 FlyBaseID:FBgn0037944 Length:1265 Species:Drosophila melanogaster
Sequence 2:NP_001295484.1 Gene:znrf3 / 556813 ZFINID:ZDB-GENE-070705-263 Length:866 Species:Danio rerio


Alignment Length:162 Identity:43/162 - (26%)
Similarity:69/162 - (42%) Gaps:27/162 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly  1097 PQQQP----QAQQSPPVMQHMQRQRAIHHHMFHHHYSPL-HLEIGL-----APLSLGSRILI--- 1148
            |.::|    :...:..:|..:.:|:.....:.|....|. :.::|:     ..:||...||:   
Zfish   148 PLKRPVVYVKGTDAVKLMNIVNKQKVARARIQHRPPRPTEYFDMGIFLAFFVVVSLVCLILLIKI 212

  Fly  1149 ------APSRPNRGA--TLETIERNTLPHKYRRVRR------PSETDEDAEKCAICLNLFEIENE 1199
                  :.|..||.|  .||.:|......|::..|.      .|.:......|||||..:....|
Zfish   213 KLKQRRSQSSMNRMAIQALEKMETCKFKAKFKGQREASCGASDSVSSSSTSDCAICLEKYIDGEE 277

  Fly  1200 VRRLPCMHLFHTDCVDQWLVTNKHCPICRVDI 1231
            :|.:||.|.||..|||.||:.:..||.||.:|
Zfish   278 LRVIPCAHRFHKKCVDPWLLQHHTCPHCRHNI 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6923NP_001262484.1 zf-rbx1 <1185..1228 CDD:289448 19/42 (45%)
zf-RING_2 1187..1228 CDD:290367 19/40 (48%)
znrf3NP_001295484.1 zf-RING_2 265..306 CDD:290367 19/40 (48%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 790..811
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.