DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG6923 and RNF126

DIOPT Version :9

Sequence 1:	NP_001262484.1	Gene:	CG6923 / 41420	FlyBaseID:	FBgn0037944	Length:	1265	Species:	Drosophila melanogaster
Sequence 2:	NP_919442.1	Gene:	RNF126 / 55658	HGNCID:	21151	Length:	311	Species:	Homo sapiens

Alignment Length:	70	Identity:	24/70 - (34%)
Similarity:	40/70 - (57%)	Gaps:	1/70 - (1%)

- Green bases have known domain annotations that are detailed below.

  Fly  1186 KCAICLNLFEIENEVRRLPCMHLFHTDCVDQWLVTNKHCPICRVDIETHMPNDALPPSSSGVPDA 1250
            :|.:|.:.:.:...||:|||.||||..|:..||..:..||:||..: |.......||..:||..:
Human   228 ECPVCKDDYALGERVRQLPCNHLFHDGCIVPWLEQHDSCPVCRKSL-TGQNTATNPPGLTGVSFS 291

  Fly  1251 ANSAA 1255
            ::|::
Human   292 SSSSS 296

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG6923	NP_001262484.1	zf-rbx1	<1185..1228	CDD:289448	16/41 (39%)
CG6923	NP_001262484.1	zf-RING_2	1187..1228	CDD:290367	16/40 (40%)
RNF126	NP_919442.1	Required for interaction with BAG6. /evidence=ECO:0000269\|PubMed:24981174	5..100
		zinc_ribbon_9	10..40	CDD:373030
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	42..64
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	94..132
		Sufficient for interaction with AICDA. /evidence=ECO:0000269\|PubMed:23277564	200..304		24/70 (34%)
		RING-H2_RNF126	228..271	CDD:319715	17/42 (40%)
		RING-H2 finger (C3H2C3-type)	229..269	CDD:319715	16/39 (41%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	277..311		5/20 (25%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	1	1.010	-	-		D1249953at2759
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	1.010