DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6923 and RNF181

DIOPT Version :9

Sequence 1:NP_001262484.1 Gene:CG6923 / 41420 FlyBaseID:FBgn0037944 Length:1265 Species:Drosophila melanogaster
Sequence 2:XP_005264416.1 Gene:RNF181 / 51255 HGNCID:28037 Length:187 Species:Homo sapiens


Alignment Length:156 Identity:32/156 - (20%)
Similarity:52/156 - (33%) Gaps:55/156 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   276 DATPSTSAQSRKRQMSQFSYRKSRVLEPENESSDDG----WDLRVHNPVPPIEPTV------TII 330
            |..||...|..:..|   ....:|.|....:..|.|    ||   |:..||...||      |:|
Human     9 DCEPSDPEQETRTNM---LLELARSLFNRMDFEDLGLVVDWD---HHLPPPAAKTVVENLPRTVI 67

  Fly   331 RGSRGS---------------------DEAEIGHTDHNY-----------YNS-------RCAVA 356
            |||:.:                     :|.::|..:..|           |::       .||..
Human    68 RGSQAALTVPWAQYSSFFLFMDCWGMEEEWQLGAGEGGYQLMKIRPRLEHYSTFLRQIPVPCAAM 132

  Fly   357 GAPPDSTYIRSASCSTATHTTRSVDY 382
            ..|..:|.:||.......:::.:.|:
Human   133 SCPLMTTLMRSTDEIRLENSSSNTDW 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6923NP_001262484.1 zf-rbx1 <1185..1228 CDD:289448
zf-RING_2 1187..1228 CDD:290367
RNF181XP_005264416.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1249953at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.