DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6923 and AT3G20395

DIOPT Version :9

Sequence 1:NP_001262484.1 Gene:CG6923 / 41420 FlyBaseID:FBgn0037944 Length:1265 Species:Drosophila melanogaster
Sequence 2:NP_001078194.1 Gene:AT3G20395 / 5008015 AraportID:AT3G20395 Length:223 Species:Arabidopsis thaliana


Alignment Length:76 Identity:28/76 - (36%)
Similarity:44/76 - (57%) Gaps:10/76 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly  1155 RGATLETIERNTLPHKYRRVRRPSETDEDAEKCAICLNLFEIENEV-RRLP-CMHLFHTDCVDQW 1217
            :|.:..:|:  .:|..|.|....:::     .|:|||..:| |.|| |:|. |.|.||.:|:|:|
plant   146 KGLSKSSIQ--NIPMFYNRSEHQTKS-----SCSICLQDWE-EGEVGRKLARCGHTFHMNCIDEW 202

  Fly  1218 LVTNKHCPICR 1228
            |:..:.|||||
plant   203 LLRQETCPICR 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6923NP_001262484.1 zf-rbx1 <1185..1228 CDD:289448 21/44 (48%)
zf-RING_2 1187..1228 CDD:290367 21/42 (50%)
AT3G20395NP_001078194.1 zf-RING_2 170..213 CDD:290367 21/43 (49%)
zf-rbx1 <171..213 CDD:289448 21/42 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.