DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6923 and AT3G20395

DIOPT Version :10

Sequence 1:NP_001262484.1 Gene:CG6923 / 41420 FlyBaseID:FBgn0037944 Length:1265 Species:Drosophila melanogaster
Sequence 2:NP_001078194.1 Gene:AT3G20395 / 5008015 AraportID:AT3G20395 Length:223 Species:Arabidopsis thaliana


Alignment Length:76 Identity:28/76 - (36%)
Similarity:44/76 - (57%) Gaps:10/76 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly  1155 RGATLETIERNTLPHKYRRVRRPSETDEDAEKCAICLNLFEIENEV-RRLP-CMHLFHTDCVDQW 1217
            :|.:..:|:  .:|..|.|....:::     .|:|||..:| |.|| |:|. |.|.||.:|:|:|
plant   146 KGLSKSSIQ--NIPMFYNRSEHQTKS-----SCSICLQDWE-EGEVGRKLARCGHTFHMNCIDEW 202

  Fly  1218 LVTNKHCPICR 1228
            |:..:.|||||
plant   203 LLRQETCPICR 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6923NP_001262484.1 HRD1 <1155..>1256 CDD:227568 28/76 (37%)
RING-H2_RNF111-like 1185..1230 CDD:438137 23/46 (50%)
AT3G20395NP_001078194.1 Phage_Coat_B 33..77 CDD:428438
RING-H2_EL5-like 170..213 CDD:438124 21/43 (49%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.