DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6923 and rnf181

DIOPT Version :9

Sequence 1:NP_001262484.1 Gene:CG6923 / 41420 FlyBaseID:FBgn0037944 Length:1265 Species:Drosophila melanogaster
Sequence 2:NP_001011200.1 Gene:rnf181 / 496625 XenbaseID:XB-GENE-964051 Length:156 Species:Xenopus tropicalis


Alignment Length:130 Identity:40/130 - (30%)
Similarity:61/130 - (46%) Gaps:13/130 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly  1107 PPVMQHMQRQRAIHHHMFHHHYSPLHLEIGLAPLSLGSRILIAPSRPNRGATLETIERNTLPHKY 1171
            |.|.:...||.|: ..:.....|.:.:::|....:...:.|..|      |..:.:|  :||   
 Frog    12 PTVPEEQYRQNAL-LELARSLLSGMDIDLGALDFTEWDQRLPPP------AAKKVVE--SLP--- 64

  Fly  1172 RRVRRPSETDEDAEKCAICLNLFEIENEVRRLPCMHLFHTDCVDQWLVTNKHCPICRVDIETHMP 1236
             :|....|..:.|.||.:||..||....||:|||.||||:.|:..||.....||:||.::.|..|
 Frog    65 -KVTVTPEQADAALKCPVCLLEFEEGETVRQLPCEHLFHSSCILPWLGKTNSCPLCRHELPTDSP 128

  Fly  1237  1236
             Frog   129  128

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6923NP_001262484.1 zf-rbx1 <1185..1228 CDD:289448 20/42 (48%)
zf-RING_2 1187..1228 CDD:290367 19/40 (48%)
rnf181NP_001011200.1 PEX10 <10..126 CDD:227861 38/126 (30%)
RING-H2_RNF181 78..123 CDD:319583 22/44 (50%)
RING-H2 finger (C3H2C3-type) 79..119 CDD:319583 19/39 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1249953at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.