powered by:
Protein Alignment CG6923 and CG7694
DIOPT Version :9
Sequence 1: | NP_001262484.1 |
Gene: | CG6923 / 41420 |
FlyBaseID: | FBgn0037944 |
Length: | 1265 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001138076.1 |
Gene: | CG7694 / 42230 |
FlyBaseID: | FBgn0038627 |
Length: | 147 |
Species: | Drosophila melanogaster |
Alignment Length: | 59 |
Identity: | 22/59 - (37%) |
Similarity: | 34/59 - (57%) |
Gaps: | 1/59 - (1%) |
- Green bases have known domain annotations that are detailed below.
Fly 1179 ETDEDAE-KCAICLNLFEIENEVRRLPCMHLFHTDCVDQWLVTNKHCPICRVDIETHMP 1236
::||..: :|::|....|...:.|.|||.|.||.:|:..||.....||:||.::||..|
Fly 61 KSDEGGDLECSVCKEPAEEGQKYRILPCKHEFHEECILLWLKKTNSCPLCRYELETDDP 119
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1249953at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.920 |
|
Return to query results.
Submit another query.