DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6923 and rnf181

DIOPT Version :9

Sequence 1:NP_001262484.1 Gene:CG6923 / 41420 FlyBaseID:FBgn0037944 Length:1265 Species:Drosophila melanogaster
Sequence 2:NP_956600.1 Gene:rnf181 / 393276 ZFINID:ZDB-GENE-040426-1024 Length:156 Species:Danio rerio


Alignment Length:57 Identity:25/57 - (43%)
Similarity:35/57 - (61%) Gaps:1/57 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly  1177 PSETDEDAEKCAICLNLFEIENEVRRLPCMHLFHTDCVDQWLVTNKHCPICRVDIET 1233
            |.:.|:.. ||.:||..||.:..||.:||.|||||.|:..||.....||:||:::.|
Zfish    70 PEQADKGV-KCPVCLLEFEEQESVREMPCKHLFHTGCILPWLNKTNSCPLCRLELPT 125

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6923NP_001262484.1 zf-rbx1 <1185..1228 CDD:289448 20/42 (48%)
zf-RING_2 1187..1228 CDD:290367 19/40 (48%)
rnf181NP_956600.1 zf-RING_2 79..120 CDD:290367 19/40 (48%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 135..156
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1249953at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.