powered by:
Protein Alignment CG6923 and rnf181
DIOPT Version :9
Sequence 1: | NP_001262484.1 |
Gene: | CG6923 / 41420 |
FlyBaseID: | FBgn0037944 |
Length: | 1265 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_956600.1 |
Gene: | rnf181 / 393276 |
ZFINID: | ZDB-GENE-040426-1024 |
Length: | 156 |
Species: | Danio rerio |
Alignment Length: | 57 |
Identity: | 25/57 - (43%) |
Similarity: | 35/57 - (61%) |
Gaps: | 1/57 - (1%) |
- Green bases have known domain annotations that are detailed below.
Fly 1177 PSETDEDAEKCAICLNLFEIENEVRRLPCMHLFHTDCVDQWLVTNKHCPICRVDIET 1233
|.:.|:.. ||.:||..||.:..||.:||.|||||.|:..||.....||:||:::.|
Zfish 70 PEQADKGV-KCPVCLLEFEEQESVREMPCKHLFHTGCILPWLNKTNSCPLCRLELPT 125
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1249953at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
1 |
1.000 |
- |
- |
|
|
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
2 | 2.010 |
|
Return to query results.
Submit another query.