DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6923 and Traip

DIOPT Version :10

Sequence 1:NP_001262484.1 Gene:CG6923 / 41420 FlyBaseID:FBgn0037944 Length:1265 Species:Drosophila melanogaster
Sequence 2:NP_001102474.1 Gene:Traip / 367167 RGDID:1309761 Length:469 Species:Rattus norvegicus


Alignment Length:47 Identity:17/47 - (36%)
Similarity:26/47 - (55%) Gaps:2/47 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly  1187 CAICLNLFEIENEVRRLPCMHLFHTDCVDQWLVT--NKHCPICRVDI 1231
            |.||.:.|:...:|..:.|.|.||..|:.||..|  ::.||.||:.:
  Rat     7 CTICSDFFDHSRDVAAIHCGHTFHLQCLIQWFETAPSRTCPQCRIQV 53

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6923NP_001262484.1 HRD1 <1155..>1256 CDD:227568 17/47 (36%)
RING-H2_RNF111-like 1185..1230 CDD:438137 17/44 (39%)
TraipNP_001102474.1 RING-H2_TRAIP 6..50 CDD:438143 15/42 (36%)
EnvC 65..>279 CDD:443969
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.