DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6923 and Rnf149

DIOPT Version :9

Sequence 1:NP_001262484.1 Gene:CG6923 / 41420 FlyBaseID:FBgn0037944 Length:1265 Species:Drosophila melanogaster
Sequence 2:XP_017452282.1 Gene:Rnf149 / 363222 RGDID:1308460 Length:394 Species:Rattus norvegicus


Alignment Length:111 Identity:37/111 - (33%)
Similarity:64/111 - (57%) Gaps:21/111 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly  1151 SRPNRGATLETIER---NTLPHKYRRVRRPSETDEDAEKCAICLNLFEIENEVRRLPCMHLFHTD 1212
            |:.:|..|.:.|.:   :|:.|..:.:      |.|||.||:|:..|::::.:|.|||.|:||..
  Rat   232 SQNHRKETKKVIGQLPLHTVKHGEKGI------DVDAENCAVCIENFKVKDVIRILPCKHIFHRI 290

  Fly  1213 CVDQWLVTNKHCPICRVDIETHM-----PNDA--LPPSSSGVPDAA 1251
            |:|.||:.::.||:|::|:...:     |.||  ||     :|:||
  Rat   291 CIDPWLLDHRTCPMCKLDVIKALGYWGDPEDAQDLP-----IPEAA 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6923NP_001262484.1 zf-rbx1 <1185..1228 CDD:289448 18/42 (43%)
zf-RING_2 1187..1228 CDD:290367 17/40 (43%)
Rnf149XP_017452282.1 PA_GRAIL_like 45..181 CDD:239037
UPF0233 <200..>220 CDD:299753
zf-RING_2 263..306 CDD:290367 18/42 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D442767at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.