DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6923 and Rnf128

DIOPT Version :9

Sequence 1:NP_001262484.1 Gene:CG6923 / 41420 FlyBaseID:FBgn0037944 Length:1265 Species:Drosophila melanogaster
Sequence 2:NP_001166820.1 Gene:Rnf128 / 315911 RGDID:1566282 Length:428 Species:Rattus norvegicus


Alignment Length:418 Identity:83/418 - (19%)
Similarity:145/418 - (34%) Gaps:139/418 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   910 VSPPPPLEMY----SGRSTI----------PHC-GSPPFSVRRSEA---AYSNRQHYQPQPH--- 953
            :.|||.:.:|    .|.:.:          ||. ||     |.:||   ||.|.....|.|.   
  Rat     1 MGPPPGIGVYCRGGCGAARLLAWCFLLALSPHAPGS-----RGAEAVWTAYLNVSWRVPHPGVNR 60

  Fly   954 ----------QGHQAPQNQMHAHIHPPHRASAIVATSLTPAPPYPVHQNLWYRQQSMQEMHRRHM 1008
                      .|..:|...:...:.||....|:.|.:                      .|....
  Rat    61 TVWELSEEGVYGQDSPLEPVSGVLVPPDGPGALNACN----------------------PHTNFT 103

  Fly  1009 TPTPIDLSSNAPLLTSTLRNGYLHSICSCVHARNGPVSSLDPAYYPPYDAAPAAAAPPPSPQQQS 1073
            .||         :..||::..:|..|     .|.|..:..|..:. .|:...:.|.....|    
  Rat   104 VPT---------VWGSTVQVSWLALI-----QRGGGCTFADKIHL-AYERGASGAVIFNFP---- 149

  Fly  1074 PATSGSGNSSVAAQASMRHLQLQPQQQPQA----------QQSPPVMQHMQRQRAI--------H 1120
                |:.|..:            |...|.|          .:...::|.:||...:        .
  Rat   150 ----GTRNEVI------------PMSHPGAGDIVAIMIGNLKGTKILQSIQRGIQVTMVIEVGKK 198

  Fly  1121 HHMFHHHYSPLHLEIG---LAPLSLGSRILIAPSRPNRGATLETIERNTLPHKYRRV-------- 1174
            |..:.:|||...:.:.   :...::|..|..: :|..|.|..::.::..|....::.        
  Rat   199 HGPWVNHYSIFFVSVSFFIITAATVGYFIFYS-ARRLRNARAQSRKQRQLKADAKKAIGRLQLRT 262

  Fly  1175 --RRPSETDEDAEKCAICLNLFEIENEVRRLPCMHLFHTDCVDQWLVTNKHCPICR--------- 1228
              :...|...|.:.||:|:.|::..:.||.|.|.|:||..|||.||:.::.||:|:         
  Rat   263 LKQGDKEIGPDGDSCAVCIELYKPNDVVRILTCNHIFHKTCVDPWLLEHRTCPMCKCDILKALGI 327

  Fly  1229 -VDIETHMPNDALPPSSSGVPDAANSAA 1255
             ||:|....:..:|.|:    :|:|:|:
  Rat   328 EVDVEDGSVSLQVPVSN----EASNTAS 351

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6923NP_001262484.1 zf-rbx1 <1185..1228 CDD:289448 18/42 (43%)
zf-RING_2 1187..1228 CDD:290367 18/40 (45%)
Rnf128NP_001166820.1 PA_GRAIL_like 48..193 CDD:239037 30/201 (15%)
zf-RING_2 275..318 CDD:290367 18/42 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D442767at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.