DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6923 and Rnf181

DIOPT Version :10

Sequence 1:NP_001262484.1 Gene:CG6923 / 41420 FlyBaseID:FBgn0037944 Length:1265 Species:Drosophila melanogaster
Sequence 2:NP_001007648.1 Gene:Rnf181 / 297337 RGDID:1359698 Length:165 Species:Rattus norvegicus


Alignment Length:110 Identity:31/110 - (28%)
Similarity:46/110 - (41%) Gaps:33/110 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly  1124 FHHHYSPLHLEIGLAPLSLGSRILIAPSRPNRGATLETIERNTLPHKYRRVRRPSETDEDAEKCA 1188
            :.||..|                      |...|.:|::.|..:        |.|:.:   .||.
  Rat    58 WEHHLPP----------------------PAAKAVVESLPRTVI--------RSSKAE---LKCP 89

  Fly  1189 ICLNLFEIENEVRRLPCMHLFHTDCVDQWLVTNKHCPICRVDIET 1233
            :||..||.|..|..:||.||||::|:..||.....||:||.::.|
  Rat    90 VCLLEFEEEETVIEMPCHHLFHSNCILPWLSKTNSCPLCRHELPT 134

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6923NP_001262484.1 HRD1 <1155..>1256 CDD:227568 27/79 (34%)
RING-H2_RNF111-like 1185..1230 CDD:438137 21/44 (48%)
Rnf181NP_001007648.1 RING-H2_RNF181 87..132 CDD:438331 21/44 (48%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 136..165
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.