DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6923 and AT5G52155

DIOPT Version :9

Sequence 1:NP_001262484.1 Gene:CG6923 / 41420 FlyBaseID:FBgn0037944 Length:1265 Species:Drosophila melanogaster
Sequence 2:NP_001332002.1 Gene:AT5G52155 / 28721267 AraportID:AT5G52155 Length:182 Species:Arabidopsis thaliana


Alignment Length:218 Identity:43/218 - (19%)
Similarity:71/218 - (32%) Gaps:68/218 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly  1028 NGYLHSICSCVHARNGPVSSLDPAYYPPYDAAPAAAAPPPSPQQQSPATSGS-------GNSSVA 1085
            |...|. |.|..         ...|:.||.:.|....      ...|:|||.       ||||  
plant    18 NSQYHG-CPCCR---------QSQYHSPYCSTPFFHL------HDVPSTSGRFYGYNSYGNSS-- 64

  Fly  1086 AQASMRHLQLQPQQQPQAQQSPPVMQHMQRQRAIHHHMFHHHYSPLHLEIGLAPLSLGSRILIAP 1150
                       |.|....:.|..:..         |..::...:.:...:|              
plant    65 -----------PDQHTLRRSSSDISL---------HSFYNEGLNEVEASVG-------------- 95

  Fly  1151 SRPNRGATLETIERNTLPHKYRRV-------RRPSETDEDAEKCAICLNLFEIENEVRRLPCMHL 1208
              ...|...|........|||.:.       ::..:...|..:|:|||..:|..:::..|||.|:
plant    96 --DESGGVPEWKISKFRTHKYGKKLKFRWWWQKKKKFVADDSQCSICLVDYEKGDKIMTLPCNHI 158

  Fly  1209 FHTDCVDQWLVTNKHCPICRVDI 1231
            :|.||:..|...|:.|.:|:.::
plant   159 YHKDCISYWFKENRVCCVCKREV 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6923NP_001262484.1 zf-rbx1 <1185..1228 CDD:289448 15/42 (36%)
zf-RING_2 1187..1228 CDD:290367 15/40 (38%)
AT5G52155NP_001332002.1 RING_Ubox 136..178 CDD:418438 15/41 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.