DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6923 and LOC100536511

DIOPT Version :9

Sequence 1:NP_001262484.1 Gene:CG6923 / 41420 FlyBaseID:FBgn0037944 Length:1265 Species:Drosophila melanogaster
Sequence 2:XP_021329973.1 Gene:LOC100536511 / 100536511 -ID:- Length:400 Species:Danio rerio


Alignment Length:96 Identity:30/96 - (31%)
Similarity:50/96 - (52%) Gaps:11/96 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly  1162 IERNTLPHKYRRVRRPSETDEDAEKCAICLNLFEIENEVRRLPCMHLFHTDCVDQWLVTNKHCPI 1226
            :|..||     |...| |.|.|...|.:|.:.::...:|..|||.||:|..|::.||:.:..||:
Zfish   243 LEVRTL-----RTNDP-EVDSDDTGCVVCTDSYQRGEQVTVLPCRHLYHKKCIEPWLLEHPTCPM 301

  Fly  1227 CRVDI-ETHMPNDAL----PPSSSGVPDAAN 1252
            |:.:| ::.:..|:.    |.|||....::|
Zfish   302 CKYNILKSSIEEDSYDQPSPSSSSSSSSSSN 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6923NP_001262484.1 zf-rbx1 <1185..1228 CDD:289448 14/42 (33%)
zf-RING_2 1187..1228 CDD:290367 14/40 (35%)
LOC100536511XP_021329973.1 PA_GRAIL_like 47..179 CDD:239037
zf-rbx1 <188..303 CDD:331150 22/65 (34%)
RING_Ubox 262..308 CDD:327409 16/45 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D442767at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.