DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6923 and pja2

DIOPT Version :9

Sequence 1:NP_001262484.1 Gene:CG6923 / 41420 FlyBaseID:FBgn0037944 Length:1265 Species:Drosophila melanogaster
Sequence 2:XP_004910519.4 Gene:pja2 / 100379719 XenbaseID:XB-GENE-966471 Length:727 Species:Xenopus tropicalis


Alignment Length:73 Identity:28/73 - (38%)
Similarity:37/73 - (50%) Gaps:6/73 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly  1187 CAICLNLFEIENEVRRLPCMHLFHTDCVDQWLVTNKHCPICR-VDIETHMPNDALPP---SSSGV 1247
            ||||.:.:..:..:..|||.||||..||..||..:..||:|| |...:|  .||...   |....
 Frog   654 CAICCSEYIKDEILTELPCHHLFHKPCVTLWLQKSGTCPVCRHVLASSH--TDAAATSFLSDHES 716

  Fly  1248 PDAANSAA 1255
            |.:.:|||
 Frog   717 PPSIHSAA 724

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6923NP_001262484.1 zf-rbx1 <1185..1228 CDD:289448 17/40 (43%)
zf-RING_2 1187..1228 CDD:290367 17/40 (43%)
pja2XP_004910519.4 RING-H2_PJA1_2 653..698 CDD:319379 19/43 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1249953at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.