powered by:
Protein Alignment CG6923 and pja2
DIOPT Version :9
Sequence 1: | NP_001262484.1 |
Gene: | CG6923 / 41420 |
FlyBaseID: | FBgn0037944 |
Length: | 1265 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_004910519.4 |
Gene: | pja2 / 100379719 |
XenbaseID: | XB-GENE-966471 |
Length: | 727 |
Species: | Xenopus tropicalis |
Alignment Length: | 73 |
Identity: | 28/73 - (38%) |
Similarity: | 37/73 - (50%) |
Gaps: | 6/73 - (8%) |
- Green bases have known domain annotations that are detailed below.
Fly 1187 CAICLNLFEIENEVRRLPCMHLFHTDCVDQWLVTNKHCPICR-VDIETHMPNDALPP---SSSGV 1247
||||.:.:..:..:..|||.||||..||..||..:..||:|| |...:| .||... |....
Frog 654 CAICCSEYIKDEILTELPCHHLFHKPCVTLWLQKSGTCPVCRHVLASSH--TDAAATSFLSDHES 716
Fly 1248 PDAANSAA 1255
|.:.:|||
Frog 717 PPSIHSAA 724
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1249953at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.920 |
|
Return to query results.
Submit another query.