DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6923 and rnf115

DIOPT Version :9

Sequence 1:NP_001262484.1 Gene:CG6923 / 41420 FlyBaseID:FBgn0037944 Length:1265 Species:Drosophila melanogaster
Sequence 2:NP_001135621.1 Gene:rnf115 / 100216180 XenbaseID:XB-GENE-993231 Length:295 Species:Xenopus tropicalis


Alignment Length:199 Identity:46/199 - (23%)
Similarity:65/199 - (32%) Gaps:77/199 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly  1125 HHHYSPLHLEIGLA------PLS-LGSRILIAPSRPNRGATLETIERNTL------------PH- 1169
            |....|.|.|:.|.      |:: ..||:   .|||:|...:|.|.:...            || 
 Frog    96 HERGHPAHTELRLTRRPPRQPMTRYRSRV---SSRPDRSPAIEGIIQQIFAGVFANPPFPGSPHP 157

  Fly  1170 -----------------------------------------KYRRVRRPSETDEDAE-----KCA 1188
                                                     |.:.|..|:.|....:     :|.
 Frog   158 LSWSGMLHSNPGDYAWGQSGLDSIVTQLLGQLENTGPPPADKDKIVSLPTVTVTREQVAMGLECP 222

  Fly  1189 ICLNLFEIENEVRRLPCMHLFHTDCVDQWLVTNKHCPICRVDIETHMPNDALPPS--------SS 1245
            :|...:.||.:||:|||.|.||.||:..||..:..||:||..:.........|.|        ||
 Frog   223 VCKEDYAIEEQVRQLPCNHFFHGDCIVPWLELHDTCPVCRKSLNGEDSTRQAPSSEASGSNNFSS 287

  Fly  1246 GVPD 1249
            ..||
 Frog   288 DSPD 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6923NP_001262484.1 zf-rbx1 <1185..1228 CDD:289448 18/47 (38%)
zf-RING_2 1187..1228 CDD:290367 18/40 (45%)
rnf115NP_001135621.1 zinc_ribbon_9 11..40 CDD:373030
RING-H2_RNF115 219..265 CDD:319714 20/45 (44%)
RING-H2 finger (C3H2C3-type) 221..261 CDD:319714 18/39 (46%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1249953at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.