DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6923 and rnf130

DIOPT Version :9

Sequence 1:NP_001262484.1 Gene:CG6923 / 41420 FlyBaseID:FBgn0037944 Length:1265 Species:Drosophila melanogaster
Sequence 2:NP_001107712.1 Gene:rnf130 / 100124963 XenbaseID:XB-GENE-949564 Length:419 Species:Xenopus tropicalis


Alignment Length:97 Identity:33/97 - (34%)
Similarity:50/97 - (51%) Gaps:19/97 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly  1172 RRVRR-PSETDEDAEKCAICLNLFEIENEVRRLPCMHLFHTDCVDQWLVTNKHCPICRVD----- 1230
            |.|:: ..|||.|.:.||:|:..::..:.||.|||.|:||..|||.||..:..||:|:::     
 Frog   248 RTVKKGDKETDPDFDHCAVCIESYKQNDIVRVLPCKHVFHKVCVDPWLSEHCTCPMCKLNILKAL 312

  Fly  1231 -IETHMP---NDAL---------PPSSSGVPD 1249
             |..::|   |.|.         |||....|:
 Frog   313 GIAANVPCTDNVAFDMERLTRSQPPSRRSAPN 344

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6923NP_001262484.1 zf-rbx1 <1185..1228 CDD:289448 18/42 (43%)
zf-RING_2 1187..1228 CDD:290367 18/40 (45%)
rnf130NP_001107712.1 PA_GRAIL_like 41..179 CDD:239037
HRD1 <197..344 CDD:227568 32/95 (34%)
RING_Ubox 262..310 CDD:388418 19/47 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D442767at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.