Sequence 1: | NP_001262484.1 | Gene: | CG6923 / 41420 | FlyBaseID: | FBgn0037944 | Length: | 1265 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001076486.1 | Gene: | rnf126 / 100009648 | ZFINID: | ZDB-GENE-070209-292 | Length: | 309 | Species: | Danio rerio |
Alignment Length: | 210 | Identity: | 49/210 - (23%) |
---|---|---|---|
Similarity: | 78/210 - (37%) | Gaps: | 71/210 - (33%) |
- Green bases have known domain annotations that are detailed below.
Fly 1085 AAQASMRHLQLQPQQQPQAQQSPPVMQHMQRQRAIHHHMFHHHYSPLHLEIGLAPLSLGSRILIA 1149
Fly 1150 PSRPNR-----------------GAT-LETIERNTLPHKYRRVRRPSETDEDAEK---------- 1186
Fly 1187 -------CAICLNLFEIENEVRRLPCMHLFHTDCVDQWLVTNKHCPICRVDIETHMPNDAL-PPS 1243
Fly 1244 SSGV---PDAANSAA 1255 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG6923 | NP_001262484.1 | zf-rbx1 | <1185..1228 | CDD:289448 | 18/59 (31%) |
zf-RING_2 | 1187..1228 | CDD:290367 | 17/40 (43%) | ||
rnf126 | NP_001076486.1 | zinc_ribbon_9 | 10..40 | CDD:291067 | |
zf-RING_2 | 225..267 | CDD:290367 | 17/41 (41%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1249953at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.010 |