DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6923 and rnf126

DIOPT Version :9

Sequence 1:NP_001262484.1 Gene:CG6923 / 41420 FlyBaseID:FBgn0037944 Length:1265 Species:Drosophila melanogaster
Sequence 2:NP_001076486.1 Gene:rnf126 / 100009648 ZFINID:ZDB-GENE-070209-292 Length:309 Species:Danio rerio


Alignment Length:210 Identity:49/210 - (23%)
Similarity:78/210 - (37%) Gaps:71/210 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly  1085 AAQASMRHLQLQPQQQPQAQQSPPVMQHMQRQRAIHHHMFHHHYSPLHLEIGLAPLSLGSRILIA 1149
            |.|...||:   |::|.|..:..|.::.:.:|                         |.:.|:..
Zfish   119 ARQPRGRHV---PRRQGQRHEGVPTLEGIIQQ-------------------------LVNGIIAP 155

  Fly  1150 PSRPNR-----------------GAT-LETIERNTLPHKYRRVRRPSETDEDAEK---------- 1186
            .:.||.                 ||. |:.|....| :::... .|...|:|..|          
Zfish   156 TAMPNMAMGPWGMLHSNPMDYAWGANGLDAIITQLL-NQFENT-GPPPADKDKIKSLPTVQIKQE 218

  Fly  1187 -------CAICLNLFEIENEVRRLPCMHLFHTDCVDQWLVTNKHCPICRVDIETHMPNDAL-PPS 1243
                   |.:|...:.....||:|||.||||.||:..||..:..||:||..:...  |.|. ||.
Zfish   219 HVGAGLECPVCKEDYSAGENVRQLPCNHLFHNDCIVPWLEQHDTCPVCRKSLSGQ--NTATDPPG 281

  Fly  1244 SSGV---PDAANSAA 1255
            .||:   |.:::|::
Zfish   282 LSGMNFSPSSSSSSS 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6923NP_001262484.1 zf-rbx1 <1185..1228 CDD:289448 18/59 (31%)
zf-RING_2 1187..1228 CDD:290367 17/40 (43%)
rnf126NP_001076486.1 zinc_ribbon_9 10..40 CDD:291067
zf-RING_2 225..267 CDD:290367 17/41 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1249953at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.