DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14721 and TPK1

DIOPT Version :9

Sequence 1:NP_650110.3 Gene:CG14721 / 41417 FlyBaseID:FBgn0037942 Length:345 Species:Drosophila melanogaster
Sequence 2:NP_001321568.1 Gene:TPK1 / 839303 AraportID:AT1G02880 Length:273 Species:Arabidopsis thaliana


Alignment Length:293 Identity:81/293 - (27%)
Similarity:133/293 - (45%) Gaps:56/293 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 HSATHRFLCTKTTIGFRQQMDHTIPPKEYKWTPGNLINENFKLGDHGHVCVVLNRQIQVPAHVVK 116
            ||::....|.:|:.|.|                              :..||||:.:   .....
plant     9 HSSSFLLPCDETSTGTR------------------------------YALVVLNQSL---PRFTP 40

  Fly   117 LLWKNAAVRCAVDGGSNHWRDFVV-------AQAMSKKANGSAPTTPLEPLDVITGDFDSITEET 174
            |||::|.:|...|||:|...|.:.       |.|:..::|......|    |||.||.|||..:.
plant    41 LLWEHAKLRLCADGGANRIYDELPLFFPNEDALAIRNRSNFLKLYKP----DVIKGDMDSIRRDV 101

  Fly   175 VDFF-----KTTPKVHTPDQDATDFTKAMAVLQPVMTQRKIQ--DVVVFHDTSGRLDQVMANLNT 232
            :||:     |...:.|  |||.||..|.:..::.....::..  .::......||.|....|||.
plant   102 LDFYINLGTKVIDESH--DQDTTDLDKCILYIRHSTLNQETSGLQILATGALGGRFDHEAGNLNV 164

  Fly   233 LYKSQKDNCNVFLLSGDSVTWLLRPGKHTIQVPVDLVTSQRWCSLMPVGSSAHNVTTTGLKWNLY 297
            ||:  ..:..:.|||.|.:..|| |..|..::.:........|.|:|:|:.:...||:||:|:|.
plant   165 LYR--YPDTRIVLLSDDCLIQLL-PKTHRHEIHIQSSLEGPHCGLIPIGTPSAKTTTSGLQWDLS 226

  Fly   298 HAQLEFGGMVSTSNTYATEFVQVETDANLIWSM 330
            :.::.|||::||||....|.:.||:|::|:|::
plant   227 NTEMRFGGLISTSNLVKEEKITVESDSDLLWTI 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14721NP_650110.3 TPK 100..328 CDD:153431 74/241 (31%)
thi_PPkinase 101..330 CDD:273588 75/242 (31%)
TPK1NP_001321568.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 61 1.000 Domainoid score I3820
eggNOG 1 0.900 - - E1_COG1564
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 113 1.000 Inparanoid score I2048
OMA 1 1.010 - - QHG54595
OrthoDB 1 1.010 - - D1428589at2759
OrthoFinder 1 1.000 - - FOG0005247
OrthoInspector 1 1.000 - - otm2991
orthoMCL 1 0.900 - - OOG6_101973
Panther 1 1.100 - - LDO PTHR13622
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X3766
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1312.930

Return to query results.
Submit another query.