DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14721 and Tpk1

DIOPT Version :9

Sequence 1:NP_650110.3 Gene:CG14721 / 41417 FlyBaseID:FBgn0037942 Length:345 Species:Drosophila melanogaster
Sequence 2:NP_001128466.1 Gene:Tpk1 / 680668 RGDID:1589408 Length:243 Species:Rattus norvegicus


Alignment Length:266 Identity:103/266 - (38%)
Similarity:148/266 - (55%) Gaps:33/266 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 MDHTIPPKEYKWTPGNLINENFKLGDHGHVCVVLNRQIQVPAHVVKLLWKNAAVRCAVDGGSNHW 135
            |:|...|.|.....|:|   .|.|       ||||:.:.  .| .:.||:.|.:|...|||:||.
  Rat     1 MEHVFTPLEPLLPTGDL---KFCL-------VVLNQTLD--PH-FRHLWRKALLRACADGGANHL 52

  Fly   136 RDFVVAQAMSKKANGSAPTTPLEPLDVITGDFDSITEETVDFF--KTTPKVHTPDQDATDFTKAM 198
            .|....:..|           ..| :.|.||||||..|..:::  |....:.|||||.|||||.:
  Rat    53 YDLTEGERES-----------FLP-EFINGDFDSIRPEVKEYYTKKGCDLISTPDQDHTDFTKCL 105

  Fly   199 AVLQPVMTQRKIQ-DVVV-FHDTSGRLDQVMANLNTLYKSQK-DNCNVFLLSGDSVTWLLRPGKH 260
            .|||..:.::::| ||:| .....||.||:||::|||:::.. ....:.::..:|:.:||:||||
  Rat   106 QVLQRKIEEKELQVDVIVTLGGLGGRFDQIMASVNTLFQATDIIPVPIIIIQKESLIYLLQPGKH 170

  Fly   261 TIQVPVDLVTSQRWCSLMPVGSSAHNVTTTGLKWNLYHAQLEFGGMVSTSNTY-ATEFVQVETDA 324
            .::|...:..|  ||.|:|||...::||||||||||.:..|.||.:||||||| .:..|.||||.
  Rat   171 RLRVDTGMEGS--WCGLIPVGQPCNHVTTTGLKWNLTNDVLGFGTLVSTSNTYDGSGLVTVETDH 233

  Fly   325 NLIWSM 330
            .|:|:|
  Rat   234 PLLWTM 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14721NP_650110.3 TPK 100..328 CDD:153431 93/233 (40%)
thi_PPkinase 101..330 CDD:273588 94/234 (40%)
Tpk1NP_001128466.1 TPK 20..239 CDD:153431 95/242 (39%)
PLN02714 21..241 CDD:178316 96/243 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166340691
Domainoid 1 1.000 77 1.000 Domainoid score I8664
eggNOG 1 0.900 - - E1_COG1564
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H6960
Inparanoid 1 1.050 152 1.000 Inparanoid score I4267
OMA 1 1.010 - - QHG54595
OrthoDB 1 1.010 - - D1428589at2759
OrthoFinder 1 1.000 - - FOG0005247
OrthoInspector 1 1.000 - - oto98315
orthoMCL 1 0.900 - - OOG6_101973
Panther 1 1.100 - - LDO PTHR13622
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X3766
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1514.770

Return to query results.
Submit another query.