DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14721 and tpk1

DIOPT Version :9

Sequence 1:NP_650110.3 Gene:CG14721 / 41417 FlyBaseID:FBgn0037942 Length:345 Species:Drosophila melanogaster
Sequence 2:XP_012820234.2 Gene:tpk1 / 549924 XenbaseID:XB-GENE-958035 Length:250 Species:Xenopus tropicalis


Alignment Length:275 Identity:104/275 - (37%)
Similarity:147/275 - (53%) Gaps:32/275 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 RQQMDHTIPPKEYKWTPGNLINENFKLGDHGHVCVVLNRQIQVPAHVVKLLWKNAAVRCAVDGGS 132
            |.:|::|..|.|.....|||          .:..::||:.:.  ..::..||:.|..:...|||:
 Frog     2 RLKMENTFTPLECLQPAGNL----------KYCLIILNQPLD--KSLLIHLWETAIFKACADGGA 54

  Fly   133 NHWRDFVVAQAMSKKANGSAPTTPLEPLDVITGDFDSITEETVDFFKT--TPKVHTPDQDATDFT 195
            |.     :.|||....:...|       |.|:||||||..|...|:|.  ...:.|||||.||||
 Frog    55 NR-----LYQAMEGSQDRYLP-------DFISGDFDSIKPEIKTFYKEQGCELIQTPDQDFTDFT 107

  Fly   196 KAMAVLQPVMTQRKIQ-DV-VVFHDTSGRLDQVMANLNTLYKSQKDNCNVFLLSGDSVTWLLRPG 258
            |.:.:||..:.|..:: || ||.....||.||:||::.|||.:... ..|.::...|:..||:||
 Frog   108 KCLKILQDKIRQSNVEMDVIVVLGGLGGRFDQIMASVETLYHAVTP-LPVIIMQDTSLICLLKPG 171

  Fly   259 KHTIQVPVDLVTSQRWCSLMPVGSSAHNVTTTGLKWNLYHAQLEFGGMVSTSNTY-ATEFVQVET 322
            ||.:.|...  ...:||.|:||||:.::||||||||||....|:||.:|||||:| .|..|.|||
 Frog   172 KHILHVATG--KEAKWCGLIPVGSACNSVTTTGLKWNLSAGVLKFGTLVSTSNSYDGTGVVTVET 234

  Fly   323 DANLIWSMGAYEFED 337
            |..|:|:||..:..|
 Frog   235 DNPLVWTMGIKKMND 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14721NP_650110.3 TPK 100..328 CDD:153431 92/232 (40%)
thi_PPkinase 101..330 CDD:273588 93/233 (40%)
tpk1XP_012820234.2 PLN02714 25..244 CDD:178316 94/235 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 74 1.000 Domainoid score I9029
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H6960
Inparanoid 1 1.050 156 1.000 Inparanoid score I4199
OMA 1 1.010 - - QHG54595
OrthoDB 1 1.010 - - D1428589at2759
OrthoFinder 1 1.000 - - FOG0005247
OrthoInspector 1 1.000 - - oto105008
Panther 1 1.100 - - LDO PTHR13622
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1532
SonicParanoid 1 1.000 - - X3766
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1212.110

Return to query results.
Submit another query.