DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14721 and tpk1

DIOPT Version :9

Sequence 1:NP_650110.3 Gene:CG14721 / 41417 FlyBaseID:FBgn0037942 Length:345 Species:Drosophila melanogaster
Sequence 2:NP_001006074.1 Gene:tpk1 / 450054 ZFINID:ZDB-GENE-041010-176 Length:257 Species:Danio rerio


Alignment Length:245 Identity:91/245 - (37%)
Similarity:129/245 - (52%) Gaps:29/245 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   100 VC-VVLNRQIQVPAHVVKLLWKNAAVRCAVDGGSNHWRDFVVAQAMSKKANGSAPTTPLEPLDVI 163
            :| |:||:.:.  .....:||..|.:|...|||:||     :.:....:.....|       |.|
Zfish    18 ICLVILNQPLD--ERYFHVLWSKAQIRACADGGANH-----LYRLTEGRRESFLP-------DYI 68

  Fly   164 TGDFDSITEETVDFF--KTTPKVHTPDQDATDFTKAMAVLQPVMTQRKIQ--DVVVFHDTSGRLD 224
            .||||||..|...|:  |....:.|||||.|||||.:|::...:..:|:|  .:|......||.|
Zfish    69 NGDFDSILPEVKAFYAGKNCKLMETPDQDLTDFTKCLAIMLEEIKAKKLQIDSIVTLGGLGGRFD 133

  Fly   225 QVMANLNTLYKSQK-DNCNVFLLSGDSVTWLLRPGKHTIQVPVDLVTSQRWCSLMPVGSSAHNVT 288
            |.||...||:.:|| .:..|.::...|:.:||:.|:|. |:.|:.....:||||:||||.. ..|
Zfish   134 QTMATEETLFHAQKMTDLPVVVIQDSSLAFLLKEGRHH-QLNVNTGMEGKWCSLVPVGSPC-LTT 196

  Fly   289 TTGLKWNLYHAQLEFGGMVSTSNTY-------ATEFVQVETDANLIWSMG 331
            |:||||||.:..|.||.:|||||||       ..:.|.:.||..|:||||
Zfish   197 TSGLKWNLDNQVLAFGQLVSTSNTYEDHDPKDCRKPVTITTDNPLLWSMG 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14721NP_650110.3 TPK 100..328 CDD:153431 87/240 (36%)
thi_PPkinase 101..330 CDD:273588 88/241 (37%)
tpk1NP_001006074.1 TPK 19..243 CDD:153431 87/239 (36%)
PLN02714 20..247 CDD:178316 90/243 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170580499
Domainoid 1 1.000 75 1.000 Domainoid score I9061
eggNOG 1 0.900 - - E1_COG1564
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H6960
Inparanoid 1 1.050 138 1.000 Inparanoid score I4518
OMA 1 1.010 - - QHG54595
OrthoDB 1 1.010 - - D1428589at2759
OrthoFinder 1 1.000 - - FOG0005247
OrthoInspector 1 1.000 - - oto38837
orthoMCL 1 0.900 - - OOG6_101973
Panther 1 1.100 - - LDO PTHR13622
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1532
SonicParanoid 1 1.000 - - X3766
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1615.800

Return to query results.
Submit another query.