DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14721 and TPK1

DIOPT Version :9

Sequence 1:NP_650110.3 Gene:CG14721 / 41417 FlyBaseID:FBgn0037942 Length:345 Species:Drosophila melanogaster
Sequence 2:XP_011514333.1 Gene:TPK1 / 27010 HGNCID:17358 Length:269 Species:Homo sapiens


Alignment Length:292 Identity:96/292 - (32%)
Similarity:140/292 - (47%) Gaps:59/292 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 MDHTIPPKEYKWTPGNLINENFKLGDHGHVCVVLNRQIQVPAHVVKLLWKNAAVRCAVDGGSNHW 135
            |:|...|.|...:.|||          .:..|:||:.:.   :..:.||..|.:|...|||:|..
Human     1 MEHAFTPLEPLLSTGNL----------KYCLVILNQPLD---NYFRHLWNKALLRACADGGANRL 52

  Fly   136 RDFVVAQAMSKKANGSAPTTPLEPLDVITGDFDSITEETVDFFKT-------------------- 180
            .|....:..|           ..| :.|.||||||..|..:::.|                    
Human    53 YDITEGERES-----------FLP-EFINGDFDSIRPEVREYYATKVLIFSILGTSFKEEKEPFS 105

  Fly   181 --------TPKVHTPDQDATDFTKAMAVLQPVMTQR--KIQDVVVFHDTSGRLDQVMANLNTLYK 235
                    ...:.|||||.|||||.:.:||..:.::  |:..:|.....:||.||:||::|||::
Human   106 GRREEKKGCELISTPDQDHTDFTKCLKMLQKKIEEKDLKVDVIVTLGGLAGRFDQIMASVNTLFQ 170

  Fly   236 SQK-DNCNVFLLSGDSVTWLLRPGKHTIQVPVDLVTSQRWCSLMPVGSSAHNVTTTGLKWNLYHA 299
            :.. ....:.::..:|:.:||:||||.:.  ||......||.|:|||.....||||||||||.:.
Human   171 ATHITPFPIIIIQEESLIYLLQPGKHRLH--VDTGMEGDWCGLIPVGQPCMQVTTTGLKWNLTND 233

  Fly   300 QLEFGGMVSTSNTY-ATEFVQVETDANLIWSM 330
            .|.||.:||||||| .:..|.||||..|:|:|
Human   234 VLAFGTLVSTSNTYDGSGVVTVETDHPLLWTM 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14721NP_650110.3 TPK 100..328 CDD:153431 87/259 (34%)
thi_PPkinase 101..330 CDD:273588 88/260 (34%)
TPK1XP_011514333.1 TPK 20..265 CDD:153431 88/261 (34%)
PLN02714 21..267 CDD:178316 89/262 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165147027
Domainoid 1 1.000 72 1.000 Domainoid score I9377
eggNOG 1 0.900 - - E1_COG1564
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H6960
Inparanoid 1 1.050 148 1.000 Inparanoid score I4410
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54595
OrthoDB 1 1.010 - - D1428589at2759
OrthoFinder 1 1.000 - - FOG0005247
OrthoInspector 1 1.000 - - oto91230
orthoMCL 1 0.900 - - OOG6_101973
Panther 1 1.100 - - LDO PTHR13622
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1532
SonicParanoid 1 1.000 - - X3766
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1615.800

Return to query results.
Submit another query.