DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14721 and tnr3

DIOPT Version :9

Sequence 1:NP_650110.3 Gene:CG14721 / 41417 FlyBaseID:FBgn0037942 Length:345 Species:Drosophila melanogaster
Sequence 2:NP_593291.1 Gene:tnr3 / 2543032 PomBaseID:SPAC6F12.05c Length:569 Species:Schizosaccharomyces pombe


Alignment Length:239 Identity:74/239 - (30%)
Similarity:122/239 - (51%) Gaps:27/239 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    96 DHGHVCVVLNRQIQVPAHVVKLLWKNAAVRCAVDGGSNHWRDFVVAQAMSKKANGSAPTTPLEPL 160
            |.....::||:.|.:|....:.|||.|::|...|||:|..|::               .:.|:| 
pombe   350 DQKFAVLLLNQPIDIPDDRFRTLWKRASIRVCADGGANQLRNY---------------DSSLKP- 398

  Fly   161 DVITGDFDSITEETVDFFKT--TPKVHTPDQDATDFTKAMAVLQPVMTQRKIQDVVVFHDTSGRL 223
            |.:.|||||:|:||..::|.  ...|..|.|:.|||.|...:::    :..|..:.|.....||:
pombe   399 DYVVGDFDSLTDETKAYYKEMGVNIVFDPCQNTTDFMKCHKIIK----EHGIDTIFVLCGMGGRV 459

  Fly   224 DQVMANLNTLY--KSQKDNCNVFLLSGDSVTWLLRPGKHTIQVPVDLVTSQRWCSLMPVGSSAHN 286
            |..:.|||.|:  .|..:...||||:..:|:.||:||.:.:....::...   |.|:|||.|.:.
pombe   460 DHAIGNLNHLFWAASISEKNEVFLLTELNVSTLLQPGINHVDCHDNIGLH---CGLLPVGQSVYV 521

  Fly   287 VTTTGLKWNLYHAQLEFGGMVSTSNTYATEFVQVETDANLIWSM 330
            ..|:||:||:.....:|||:||:.|......|.:|.:..::|:|
pombe   522 KKTSGLEWNIEDRICQFGGLVSSCNVVTKATVTIEVNNFIVWTM 565

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14721NP_650110.3 TPK 100..328 CDD:153431 71/231 (31%)
thi_PPkinase 101..330 CDD:273588 72/232 (31%)
tnr3NP_593291.1 DUF4743 33..131 CDD:292538
Nudix_hydrolase_3 103..282 CDD:239648
TPK 354..562 CDD:153431 71/230 (31%)
thi_PPkinase 355..565 CDD:273588 72/232 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 61 1.000 Domainoid score I3000
eggNOG 1 0.900 - - E1_COG1564
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1532
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.800

Return to query results.
Submit another query.