DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14720 and CG34429

DIOPT Version :9

Sequence 1:NP_650108.2 Gene:CG14720 / 41415 FlyBaseID:FBgn0037940 Length:204 Species:Drosophila melanogaster
Sequence 2:NP_001097598.1 Gene:CG34429 / 5740606 FlyBaseID:FBgn0085458 Length:249 Species:Drosophila melanogaster


Alignment Length:194 Identity:76/194 - (39%)
Similarity:107/194 - (55%) Gaps:28/194 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 LIFPPTSPTRVQFIGGIGIPVENLHFESVTSGYVLKAEYFLPTNSTEI----------------T 78
            ||:|..:|||:|.|.|.|||.|:|..|||.:||||||:|:||.::.::                .
  Fly    44 LIYPRANPTRLQMIAGFGIPAEDLKVESVITGYVLKAQYYLPYSAKQLRTKDVHEISESRLLQNA 108

  Fly    79 RVYLKPMAITG----------REKESPYGALYRWIIYRGIEMVIENMGLPGRSCLLRLICEHAAL 133
            .::.|.|.::.          :|.....|: |||.:|.....:...|.|.||.|:|:.|||.||.
  Fly   109 TIFDKVMQMSEQKLGFDPDILQEDLQALGS-YRWSVYEAFTALAIRMKLNGRVCVLKSICESAAA 172

  Fly   134 PLNHESGLLGEIMNIVLRPSSSVDQLGQSSDREYHTSEHFGKRGGDCQAAYASRCKKSPMELIS 197
            |.:..:|||||:::|:|.||||||.|.:.||.:|..:|..|..||||...| .||.||.:|..|
  Fly   173 PFDDRNGLLGEVLHILLTPSSSVDPLSEHSDNDYLQAERLGAAGGDCDQVY-PRCPKSLLEHFS 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14720NP_650108.2 DM4_12 96..195 CDD:214785 45/98 (46%)
CG34429NP_001097598.1 DM4_12 137..233 CDD:214785 45/97 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447049
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D151298at50557
OrthoFinder 1 1.000 - - FOG0009993
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21398
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.950

Return to query results.
Submit another query.