DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14720 and CG34442

DIOPT Version :9

Sequence 1:NP_650108.2 Gene:CG14720 / 41415 FlyBaseID:FBgn0037940 Length:204 Species:Drosophila melanogaster
Sequence 2:NP_001097311.1 Gene:CG34442 / 5740603 FlyBaseID:FBgn0085471 Length:245 Species:Drosophila melanogaster


Alignment Length:239 Identity:52/239 - (21%)
Similarity:90/239 - (37%) Gaps:60/239 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 FLSCMHLCSADGHLKRLSRSLIFPPTSPTRVQFIGGIGIPVENLHFESVTSGYVLKAEYFLPTNS 74
            |...:.||:...:...:..:|:|  |:.:.......|.:|: .|...:|...|..:..|:.|.: 
  Fly     7 FAPFLFLCAIINNFNLVKSALLF--TTNSEYGIFMAISVPI-GLPHRNVFLSYNYEFNYYQPEH- 67

  Fly    75 TEITRVYLKPMAITGREKESPY------------------------------------------- 96
                 ||..|..:.|::.|..|                                           
  Fly    68 -----VYKYPPILMGQDFEDSYLTYPTTGREAEGRHCQNCTDWKIEGNINSTSSNNNSTKAASRE 127

  Fly    97 ----GALYRWIIYRGIEMVIENMGLPGRSCLLRLICEHAALPLNHESGLLGEIMNIVLRPSSSVD 157
                ..:.|.:.|..:...:...|.|...|||||||:..|..|...:|.||.:::|:..||||.|
  Fly   128 KRGLTLMSRSVFYAMLRDKLRRSGFPAEPCLLRLICDTNASQLGEVNGFLGSLVHIIFSPSSSKD 192

  Fly   158 QLGQSSDREYHTSEHFGKRGGDCQAAYASRCKKSPMELISLLLE 201
               :....||:.:|..|:...:| :.|...|..:.::|:|:.||
  Fly   193 ---EHLPNEYYQAEWDGREQQEC-STYTKSCDHNILDLVSVSLE 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14720NP_650108.2 DM4_12 96..195 CDD:214785 30/145 (21%)
CG34442NP_001097311.1 DM4_12 136..219 CDD:285126 28/86 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452544
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21398
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.