DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14720 and CG34443

DIOPT Version :9

Sequence 1:NP_650108.2 Gene:CG14720 / 41415 FlyBaseID:FBgn0037940 Length:204 Species:Drosophila melanogaster
Sequence 2:NP_001097312.1 Gene:CG34443 / 5740580 FlyBaseID:FBgn0085472 Length:239 Species:Drosophila melanogaster


Alignment Length:214 Identity:62/214 - (28%)
Similarity:87/214 - (40%) Gaps:51/214 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 LSRSLIFPPTSPTRVQFIGGIGIPVENLHFESVTSGYVLKAEYFLPTN----------------- 73
            |:.|.:....|.|...| ..|.:|:|..| .:|...|..:|.|.||.|                 
  Fly    20 LTNSFVAFTASSTHGIF-AAIAVPLELPH-RNVFVSYNFEANYNLPANWEKWTIFQNGPIESEEV 82

  Fly    74 ----STEITRVYLKPMAITGREKESPYGA-------------------LYRWIIYRGIEMVIENM 115
                .||..|...........::|:..|:                   |.|..|||.....::..
  Fly    83 VDETDTETDRKLAAGCQNCTVKEENEAGSEEVEEITEVLPQERKVRSLLTRSNIYRIFVDKLKRS 147

  Fly   116 GLPGRSCLLRLICEHAALPLNHESGLLGEIMNIVLRPSSSVDQLGQSSD--REYHTSEHFGKRGG 178
            |..|.|||||||||.:|..|:..:|:||.:|:::..||||     :|.|  ..|:.:||.| ..|
  Fly   148 GFRGESCLLRLICETSAAQLDEFNGVLGSLMHVLFSPSSS-----ESEDLPLRYYQAEHDG-WNG 206

  Fly   179 DCQAAYASRCKKSPMELIS 197
            .|. .|...|.:|.:||||
  Fly   207 HCH-VYEPGCGESILELIS 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14720NP_650108.2 DM4_12 96..195 CDD:214785 38/119 (32%)
CG34443NP_001097312.1 DM4_12 133..215 CDD:285126 34/88 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452553
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21398
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.