DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14720 and CG17780

DIOPT Version :10

Sequence 1:NP_650108.2 Gene:CG14720 / 41415 FlyBaseID:FBgn0037940 Length:204 Species:Drosophila melanogaster
Sequence 2:NP_732995.1 Gene:CG17780 / 42914 FlyBaseID:FBgn0039197 Length:345 Species:Drosophila melanogaster


Alignment Length:93 Identity:24/93 - (25%)
Similarity:40/93 - (43%) Gaps:16/93 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   100 YRWIIYRGIEMVIENMGLPGRSCLLRLICEHAALPLNHESGLLGEIMNIVLRPSSSVDQLGQSSD 164
            :|...|..:..:|:..||.||:|:|:..|  .||..:|..|.|.:::..|.    ::|:      
  Fly   257 FRRDTYELLHELIDRSGLDGRACVLKAYC--TALAGDHGQGFLFKLLKYVF----TLDE------ 309

  Fly   165 REYHTSEHFGK-RGGDCQAAYASRCKKS 191
               |...|... |..:|:....|.|..|
  Fly   310 ---HDKRHMPHLREENCEQIMHSHCPLS 334

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14720NP_650108.2 DM4_12 96..195 CDD:214785 24/93 (26%)
CG17780NP_732995.1 DM4_12 136..>188 CDD:462285
DM4_12 253..338 CDD:214785 24/93 (26%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.