DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14720 and CG13613

DIOPT Version :9

Sequence 1:NP_650108.2 Gene:CG14720 / 41415 FlyBaseID:FBgn0037940 Length:204 Species:Drosophila melanogaster
Sequence 2:NP_001097900.2 Gene:CG13613 / 42910 FlyBaseID:FBgn0039193 Length:219 Species:Drosophila melanogaster


Alignment Length:215 Identity:58/215 - (26%)
Similarity:90/215 - (41%) Gaps:44/215 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 GHLKRLSRSLIFP-------PTSPTRVQFIGGIGIPVENLHFESVTSGYVLKAEYFLPT------ 72
            |.:..|..:||.|       ||| |.:|....|.||.:......|......:..|.||.      
  Fly    13 GQVSLLLITLIRPIYGLLLFPTS-TVLQLTSSISIPADLNTRTKVFMDMGFQMNYNLPPTVSAFY 76

  Fly    73 NST----EITR-----------VYLKPMAITGREKESPYGALYRWIIYRGIEMVIENMGLPGRSC 122
            |:|    |::|           ..|:...:.|....:.:.|   ..:|:|||.::|..|. .|||
  Fly    77 NATIWADELSRRQKRQLDHSLDANLQQYDLEGGMHPADFTA---GQLYKGIENMLETYGF-HRSC 137

  Fly   123 LLRLICEHAALPL--NHESGLLGEIMNIVLRPSSSVDQLGQSSDRE-----YHTSEHFGKRGGDC 180
            |||.:||.|..|.  :|..|::.:::..:|.||   ...|.:.|.:     |..:|..|..||.|
  Fly   138 LLRSVCELALHPFAEDHFYGMVTQVITFLLTPS---QHEGFADDEQHYRDKYEKAEQIGFLGGQC 199

  Fly   181 QAAYASRCKKSPMELISLLL 200
            ..:|.| |:...:.|.:.|:
  Fly   200 HLSYPS-CQADIINLATRLV 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14720NP_650108.2 DM4_12 96..195 CDD:214785 33/105 (31%)
CG13613NP_001097900.2 DM4_12 119..206 CDD:285126 31/91 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452604
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21398
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.