DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14720 and CG7201

DIOPT Version :10

Sequence 1:NP_650108.2 Gene:CG14720 / 41415 FlyBaseID:FBgn0037940 Length:204 Species:Drosophila melanogaster
Sequence 2:NP_648200.1 Gene:CG7201 / 38929 FlyBaseID:FBgn0035865 Length:345 Species:Drosophila melanogaster


Alignment Length:116 Identity:32/116 - (27%)
Similarity:53/116 - (45%) Gaps:18/116 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    93 ESPYGALY------RWIIYRGIEMVIENMGLPGRSCLLRLICEHAALPLNHESGLLGEIMNIVLR 151
            |.|.|..:      |.::|..:|..:...|:.|::||||.|||..:..| .:.|:.||:..:.|.
  Fly   192 ELPAGLQHIFHGGERVLLYGVVEDFLSTFGMDGKACLLRTICEMHSRSL-EKFGVFGEMTKLFLT 255

  Fly   152 PSSSVDQLGQSSD--REYHTSEHFG---KRGGDCQAAYASRCKKSPMELIS 197
            .:.|     ..||  .:|..::..|   :..|:| ..|...|.||..:.:|
  Fly   256 VTKS-----PFSDLVPDYVQAQEVGEGKQAPGEC-FPYFKDCPKSIFKALS 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14720NP_650108.2 DM4_12 96..195 CDD:214785 29/109 (27%)
CG7201NP_648200.1 DM4_12 201..298 CDD:214785 28/103 (27%)

Return to query results.
Submit another query.