DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14720 and CG33262

DIOPT Version :9

Sequence 1:NP_650108.2 Gene:CG14720 / 41415 FlyBaseID:FBgn0037940 Length:204 Species:Drosophila melanogaster
Sequence 2:NP_996071.2 Gene:CG33262 / 2768975 FlyBaseID:FBgn0053262 Length:208 Species:Drosophila melanogaster


Alignment Length:192 Identity:73/192 - (38%)
Similarity:100/192 - (52%) Gaps:38/192 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 CMHLC--------SADGHLKRLSRSLIFPPTSPTRVQFIGGIGIPVENLHFESVTSGYVLKAEYF 69
            |..||        |.|.| .|..|.||||..:|||.|||.|||||.: |.:||:|.||||||||:
  Fly    10 CATLCLIFLQEVASQDVH-SRSKRFLIFPRQAPTRHQFIAGIGIPAD-LEYESLTVGYVLKAEYY 72

  Fly    70 LPTNSTEITRVY--------LKPMAITGREKESPYGALY------RWIIYRGIEMVIENMGLPGR 120
            ||.|:|    ||        .||..|..:::..    |:      ||.:|:.||.::...||.|.
  Fly    73 LPYNAT----VYRQNPLFPEYKPNTIDAQDQRK----LFMKPTDLRWQLYQFIEHMLNGYGLNGH 129

  Fly   121 SCLLRLICEHAALPLNHESGLLGEIMNIVLRPSSSVDQLGQSSDR--EYHTSEHFGKRGGDC 180
            :|||..|||...:....:....||:::::|.|||:   |...|:|  ::..:|..|.| .||
  Fly   130 ACLLEAICEANNIKFAKDFSTAGEMLHLLLSPSST---LNSESNRALDFILAEKDGSR-RDC 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14720NP_650108.2 DM4_12 96..195 CDD:214785 29/93 (31%)
CG33262NP_996071.2 DM4_12 110..192 CDD:285126 28/82 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 48 1.000 Domainoid score I19081
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG27235
OrthoDB 1 1.010 - - D151298at50557
OrthoFinder 1 1.000 - - FOG0009993
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21398
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
66.030

Return to query results.
Submit another query.