DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14720 and CG33342

DIOPT Version :9

Sequence 1:NP_650108.2 Gene:CG14720 / 41415 FlyBaseID:FBgn0037940 Length:204 Species:Drosophila melanogaster
Sequence 2:NP_001097904.1 Gene:CG33342 / 2768684 FlyBaseID:FBgn0086610 Length:219 Species:Drosophila melanogaster


Alignment Length:182 Identity:48/182 - (26%)
Similarity:82/182 - (45%) Gaps:28/182 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 LKRLSRSLIFPPTSPTRVQFIGGIGIPVENLHFESVTSGYVLKAEYFLPTN------STEITRVY 81
            |.|..|..||......::  :.|:..|::.........|:|.....::|:.      |...|..:
  Fly    40 LSRTKRLAIFNGQGTNKI--VAGLAFPIKQADTVQSVWGFVNYQAQYVPSPVPIYWWSFWNTSTF 102

  Fly    82 LKPMAITGRE-KESPYGALYR-----WIIYRGIEMVIENMG-LPGRSCLLRLICEHAALPLNHES 139
            |.    |.|| ::.....:::     | :|..:|..:|.:| ....:|||:.|||.:..|..|.|
  Fly   103 LS----TAREWRKGIRSRVFQDETRVW-LYDVVETGLERLGDRNAGACLLKCICEISQRPFMHNS 162

  Fly   140 GLLGEIMNIVLRPSSSVDQLGQSSDREYHTSEHFGKRGGDCQAAYASRCKKS 191
             :.|||:|.||.|  |:|.:.:    :|..:.:.||.|.:|:..| |.|.|:
  Fly   163 -IFGEILNAVLVP--SLDNVPE----KYLHARNAGKAGANCRKTY-SDCSKA 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14720NP_650108.2 DM4_12 96..195 CDD:214785 32/102 (31%)
CG33342NP_001097904.1 DM4_12 123..203 CDD:285126 30/88 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452653
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21398
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.