DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ACBD7 and Acbp1

DIOPT Version :10

Sequence 1:NP_001034933.1 Gene:ACBD7 / 414149 HGNCID:17715 Length:88 Species:Homo sapiens
Sequence 2:NP_609187.1 Gene:Acbp1 / 34111 FlyBaseID:FBgn0031992 Length:90 Species:Drosophila melanogaster


Alignment Length:83 Identity:49/83 - (59%)
Similarity:59/83 - (71%) Gaps:0/83 - (0%)


- Green bases have known domain annotations that are detailed below.


Human     6 DFDRAAEDVRKLKARPDDGELKELYGLYKQAIVGDINIACPGMLDLKGKAKWEAWNLKKGLSTED 70
            :|::|||||:.|...|.|.:|.|||.|||||.|||.|...||.||.||||||||||.:||:|..|
  Fly     6 EFNQAAEDVKNLNTTPGDNDLLELYSLYKQATVGDCNTDKPGFLDFKGKAKWEAWNNRKGMSNTD 70

Human    71 ATSAYISKAKELIEKYGI 88
            |.:|||:|.|.||...|:
  Fly    71 AQAAYITKVKALIAAVGL 88

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ACBD7NP_001034933.1 ACBP 3..87 CDD:469667 48/80 (60%)
Acbp1NP_609187.1 ACBP 5..87 CDD:238248 48/80 (60%)

Return to query results.
Submit another query.