DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14718 and NRP1

DIOPT Version :9

Sequence 1:NP_650107.1 Gene:CG14718 / 41413 FlyBaseID:FBgn0037939 Length:446 Species:Drosophila melanogaster
Sequence 2:NP_010114.1 Gene:NRP1 / 851387 SGDID:S000002326 Length:719 Species:Saccharomyces cerevisiae


Alignment Length:324 Identity:64/324 - (19%)
Similarity:125/324 - (38%) Gaps:93/324 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    93 LVQEDDHFC--GAEADQQLVASTSSSCPMASSGESVSIDTEQEAERDLQMNQCETLEREELNGDI 155
            |.:|.|.:|  ..|...|..|.::::|    :.:|:||:..:.. :||.    |.:...|::...
Yeast   115 LWKEFDRWCVNHPEILGQKKAISNNNC----NTKSISINAAKNT-KDLD----EIVRILEVSIPT 170

  Fly   156 GEMGEMEELAEEVNGEQRPPLLPCMGGNTSYMVFPRTAADYMPRL----ALPRH------RPYIS 210
            .|.|.:.|:                     |.:..|| .|.:.:|    ..|..      :||.|
Yeast   171 EEAGSVPEI---------------------YSLLKRT-TDILIQLHKKCTSPEDMESVLTKPYDS 213

  Fly   211 IGQEQYVIQ--AETVFVLGMRLNVTKNDIILFFGKVGV-----------------IKMDESTNKP 256
            ....:..:|  ::.:::..:..:.|::::..:|.:.||                 :..:.|.|..
Yeast   214 HTDIRAFLQEKSKILYMNNLPPDTTQSELESWFTQYGVRPVGFWTVKNIVEDTSNVNNNWSLNNS 278

  Fly   257 KIFVYKNKITG----RSKGEATITYVSPFSAQAAISCLSGAK---FMGQVITVLPAYLST----R 310
            .....::.|:|    ::..||  |.|...:.::.:|.|:..|   .:..|:.:.|:  ||    :
Yeast   279 PYVEDQDSISGFVVFQTHEEA--TEVLALNGRSILSNLANTKQPRVVEHVLELQPS--STGVLDK 339

  Fly   311 RGSVRYSYPRELNAPEHQRRQRAMKWKPAIDNWVCMLCRNSNFVWRSSCNRCQADKVVAPQNNE 374
            ...:...:|:..|             ||...:|.|..|..|||..|::|.||   ...||.|::
Yeast   340 AQEILSPFPQSKN-------------KPRPGDWNCPSCGFSNFQRRTACFRC---SFPAPSNSQ 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14718NP_650107.1 RRM <222..>335 CDD:223796 21/140 (15%)
RRM_SF 223..302 CDD:302621 16/102 (16%)
zf-RanBP 343..366 CDD:279035 10/22 (45%)
RanBP2-type Zn finger 343..362 CDD:275375 8/18 (44%)
zf-RanBP 397..423 CDD:295417
RanBP2-type Zn finger 398..417 CDD:275375
NRP1NP_010114.1 RRM_ARP_like 226..328 CDD:409886 16/103 (16%)
zf-RanBP 355..384 CDD:395516 11/31 (35%)
RanBP2-type Zn finger 359..378 CDD:275376 8/18 (44%)
zf-RanBP 581..609 CDD:395516
RanBP2-type Zn finger 585..604 CDD:275376
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157341573
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.