DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14718 and AT4G28990

DIOPT Version :9

Sequence 1:NP_650107.1 Gene:CG14718 / 41413 FlyBaseID:FBgn0037939 Length:446 Species:Drosophila melanogaster
Sequence 2:NP_001154272.1 Gene:AT4G28990 / 829020 AraportID:AT4G28990 Length:395 Species:Arabidopsis thaliana


Alignment Length:111 Identity:35/111 - (31%)
Similarity:47/111 - (42%) Gaps:24/111 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   310 RRGSVRYSYPRELNAPE--HQR----RQRAMKWKPAIDNWVCM--LCRNSNFVWRSSCNRCQADK 366
            |.|:....|.|.|:.||  |.|    |....|.:|...:|.|:  ||||.||..|.||.:|:..:
plant   167 RGGAGARPYRRGLDGPEPPHGRDGMSRNNISKVQPREGDWYCLDPLCRNLNFARRESCYKCKRHR 231

  Fly   367 VVAPQN--------------NEGSSWAGSREED-GAPRRWRPYRND 397
             .||.|              :....:.|.|... |.||.:.|.|:|
plant   232 -YAPANSPPLPRLLPPPMNHSPRRDFNGYRSPPRGWPRDYPPPRHD 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14718NP_650107.1 RRM <222..>335 CDD:223796 10/30 (33%)
RRM_SF 223..302 CDD:302621
zf-RanBP 343..366 CDD:279035 12/24 (50%)
RanBP2-type Zn finger 343..362 CDD:275375 11/20 (55%)
zf-RanBP 397..423 CDD:295417 1/1 (100%)
RanBP2-type Zn finger 398..417 CDD:275375 35/111 (32%)
AT4G28990NP_001154272.1 DUF4220 <61..>120 CDD:290676
ZnF_RBZ 204..228 CDD:197784 11/23 (48%)
RanBP2-type Zn finger 206..227 CDD:275376 11/20 (55%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23238
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.