DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14718 and TAF15

DIOPT Version :9

Sequence 1:NP_650107.1 Gene:CG14718 / 41413 FlyBaseID:FBgn0037939 Length:446 Species:Drosophila melanogaster
Sequence 2:NP_631961.1 Gene:TAF15 / 8148 HGNCID:11547 Length:592 Species:Homo sapiens


Alignment Length:474 Identity:112/474 - (23%)
Similarity:155/474 - (32%) Gaps:162/474 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 NYSDTQQPQPQLQTQQQMFHANYIVGTTLGSGLGFNFAPAPIPQASAASGLSPRGM----YSDLY 78
            :||....|..|...|....::.|  |.|..|..|.|:           ||.|..|.    ||..|
Human    16 SYSTYGNPGSQGYGQASQSYSGY--GQTTDSSYGQNY-----------SGYSSYGQSQSGYSQSY 67

  Fly    79 -RYE---------------------DGSGDASGSLLLVQEDDHFCGAEADQQLVASTSSSCPMAS 121
             .||                     :.||...|......:.|:......|||    :.......|
Human    68 GGYENQKQSSYSQQPYNNQGQQQNMESSGSQGGRAPSYDQPDYGQQDSYDQQ----SGYDQHQGS 128

  Fly   122 SGESVSIDTEQEAERDLQMNQCETLEREELN-------GDIGEMGEMEELAEEVNGEQ------- 172
            ..|..:.|  |:.:...|..|....:||..:       .|:...||..   ....|.|       
Human   129 YDEQSNYD--QQHDSYSQNQQSYHSQRENYSHHTQDDRRDVSRYGEDN---RGYGGSQGGGRGRG 188

  Fly   173 ------RPPLLPCMGGNT-SYMVF-------PRTAADYMPRLALPRHRPYISIGQEQYVIQAETV 223
                  |.|:....||:. .:..|       |||.||                 .|.......|:
Human   189 GYDKDGRGPMTGSSGGDRGGFKNFGGHRDYGPRTDAD-----------------SESDNSDNNTI 236

  Fly   224 FVLGMRLNVTKNDIILFFGKVGVIKMDESTNKPKIFVYKNKITGRSKGEATITYVSPFSAQAAIS 288
            ||.|:...|:.:.:..||.::|:||.::.|.||.|.:|.:|.||:.|||||:::..|.||:|||.
Human   237 FVQGLGEGVSTDQVGEFFKQIGIIKTNKKTGKPMINLYTDKDTGKPKGEATVSFDDPPSAKAAID 301

  Fly   289 CLSGAKFMGQVITVLPAYLSTRRGSVRYSYPRELNAPEHQRRQRAMKWKPAIDNWVCMLCRNSNF 353
            ...|.:|.|.:|.|   ..:|||             ||..|                        
Human   302 WFDGKEFHGNIIKV---SFATRR-------------PEFMR------------------------ 326

  Fly   354 VWRSSCNRCQADKVVAPQNNEGSSWAGSREEDG-------APRRWRPYRNDWLC--KICYNMNFW 409
                                .|.|..|.|...|       ..|...|...||:|  ..|.||||.
Human   327 --------------------GGGSGGGRRGRGGYRGRGGFQGRGGDPKSGDWVCPNPSCGNMNFA 371

  Fly   410 YRAKCNRCHALRSDEMKSS 428
            .|..||:|:..|.::.:.|
Human   372 RRNSCNQCNEPRPEDSRPS 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14718NP_650107.1 RRM <222..>335 CDD:223796 40/112 (36%)
RRM_SF 223..302 CDD:302621 32/78 (41%)
zf-RanBP 343..366 CDD:279035 0/22 (0%)
RanBP2-type Zn finger 343..362 CDD:275375 0/18 (0%)
zf-RanBP 397..423 CDD:295417 13/27 (48%)
RanBP2-type Zn finger 398..417 CDD:275375 10/20 (50%)
TAF15NP_631961.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..237 52/259 (20%)
G_path_suppress <1..124 CDD:318248 27/124 (22%)
RRM 136..>315 CDD:330708 55/200 (28%)
RRM_FUS_TAF15 232..317 CDD:240979 34/87 (39%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 324..356 8/75 (11%)
zf-RanBP 354..384 CDD:279035 12/29 (41%)
RanBP2-type Zn finger 358..379 CDD:275375 10/20 (50%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 373..592 6/18 (33%)
21 X approximate tandem repeats of D-R-[S,G](0,3)-G-G-Y-G-G 407..575
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1995
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1539664at2759
OrthoFinder 1 1.000 - - FOG0002238
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_114797
Panther 1 1.100 - - O PTHR23238
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5432
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
76.850

Return to query results.
Submit another query.