DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14718 and Tex13a

DIOPT Version :9

Sequence 1:NP_650107.1 Gene:CG14718 / 41413 FlyBaseID:FBgn0037939 Length:446 Species:Drosophila melanogaster
Sequence 2:NP_080745.2 Gene:Tex13a / 67944 MGIID:1915194 Length:377 Species:Mus musculus


Alignment Length:288 Identity:57/288 - (19%)
Similarity:93/288 - (32%) Gaps:69/288 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   122 SGESVSIDTEQ----------EAERDLQMNQCETLEREELNGDIGEM----GEMEELAEEVN-GE 171
            |..|:|.|.:|          |....|||.|.: ||..:...|:..:    .|:..|...|. ..
Mouse   103 SALSLSPDLKQLIHQQEMAQKEVALQLQMAQAK-LEEVQRERDLLRLKILQAELRALPNAVRPAV 166

  Fly   172 QRPPLLPCMGG-NTSYMVFPRTAADYMPRLALPRHRPYISIGQEQYVIQAETVFVLGMRLNVTKN 235
            ..||.:...|| .|.:.......|::|   |....||..........:..          .:|..
Mouse   167 AIPPAVVRRGGIRTQWSSTKENLAEWM---AAATGRPNERANMSDTALSG----------TITSP 218

  Fly   236 DIIL------FFGKVGVIK----------MDESTNKPKIFVYKNKITGRS-----------KGEA 273
            :.:|      |...:||:|          :|....|..:..:...:..||           ....
Mouse   219 EEVLEDPNGSFMKLLGVMKCKNYPLKRQRLDLRPKKASMCSFSQSLNLRSTVSSEPFIVQLPASF 283

  Fly   274 TITYVSPFSAQAAISCLSGAKFMGQVITVLPAYLSTRRGSVRYSYPRELNAPEHQRRQRAMKW-- 336
            |.:|.|||.|....|.|...:....|      |..:....:.:.....::..:||...:..::  
Mouse   284 TYSYESPFPAIPTTSQLPTTERQPHV------YPYSMASDISHLSDMRIHRGDHQELPKDKRFSA 342

  Fly   337 --KPAIDNWVCMLCRNSNFVWRSSCNRC 362
              :|.  :|.|..|:..||..|.:|..|
Mouse   343 FRRPG--DWDCPWCKAVNFSRRENCFHC 368

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14718NP_650107.1 RRM <222..>335 CDD:223796 22/139 (16%)
RRM_SF 223..302 CDD:302621 19/105 (18%)
zf-RanBP 343..366 CDD:279035 8/20 (40%)
RanBP2-type Zn finger 343..362 CDD:275375 7/18 (39%)
zf-RanBP 397..423 CDD:295417
RanBP2-type Zn finger 398..417 CDD:275375
Tex13aNP_080745.2 TEX13 5..152 CDD:373629 13/49 (27%)
ZnF_RBZ 347..369 CDD:197784 8/24 (33%)
RanBP2-type Zn finger 349..368 CDD:275375 7/18 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167842442
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.