DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14718 and Zranb2

DIOPT Version :9

Sequence 1:NP_650107.1 Gene:CG14718 / 41413 FlyBaseID:FBgn0037939 Length:446 Species:Drosophila melanogaster
Sequence 2:NP_113804.2 Gene:Zranb2 / 58821 RGDID:61854 Length:330 Species:Rattus norvegicus


Alignment Length:80 Identity:29/80 - (36%)
Similarity:41/80 - (51%) Gaps:5/80 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   342 NWVC--MLCRNSNFVWRSSCNRCQADKVV-APQNNEGSSWAGSREEDGAPRRWRPYRNDWLCKIC 403
            :|:|  ..|.|.||..|:|||||..:|.. |.....|.:..|....:.:  |.....|||.||.|
  Rat    12 DWICPDKKCGNVNFARRTSCNRCGREKTTEAKMMKAGGTEIGKTLAEKS--RGLFSANDWQCKTC 74

  Fly   404 YNMNFWYRAKCNRCH 418
            .|:|:..|::||.|:
  Rat    75 SNVNWARRSECNMCN 89

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14718NP_650107.1 RRM <222..>335 CDD:223796
RRM_SF 223..302 CDD:302621
zf-RanBP 343..366 CDD:279035 12/24 (50%)
RanBP2-type Zn finger 343..362 CDD:275375 10/20 (50%)
zf-RanBP 397..423 CDD:295417 11/22 (50%)
RanBP2-type Zn finger 398..417 CDD:275375 9/18 (50%)
Zranb2NP_113804.2 ZnF_RBZ 11..35 CDD:197784 11/22 (50%)
RanBP2-type Zn finger 13..34 CDD:275376 10/20 (50%)
ZnF_RBZ 67..91 CDD:197784 12/23 (52%)
RanBP2-type Zn finger 69..88 CDD:275376 9/18 (50%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 117..330
Required for nuclear targeting. /evidence=ECO:0000250 151..324
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1995
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.