DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14718 and TEX13A

DIOPT Version :9

Sequence 1:NP_650107.1 Gene:CG14718 / 41413 FlyBaseID:FBgn0037939 Length:446 Species:Drosophila melanogaster
Sequence 2:NP_001278206.1 Gene:TEX13A / 56157 HGNCID:11735 Length:409 Species:Homo sapiens


Alignment Length:347 Identity:74/347 - (21%)
Similarity:120/347 - (34%) Gaps:96/347 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 SAASGLSPRGMYSDLYR----YEDGSGDASGSLLLVQEDDHFCGAEADQQLVA----STSSSCP- 118
            |||..|:     |||.:    .|....:|:..|.:.|........|.|::||:    ...:..| 
Human   102 SAAQALA-----SDLKKLREQQETERKEAASRLRMAQTSLVEVQKERDKELVSPHEWEQGAGWPG 161

  Fly   119 MASSGESVSIDTEQEAERDLQMNQCETLEREE----LNGDIGEMGEMEELAE-EVNGEQRPPLLP 178
            :|::|   .:.||..||           |.||    ..|..|..|..||..: ||.......:.|
Human   162 LATAG---GVCTEGAAE-----------EEEEAAVAAAGAAGGKGAEEEQRDVEVVAAPVEAMAP 212

  Fly   179 CMGGNTSYM--VFPRTAA--------DYMPRLALPRHRPYISIG---QEQYVIQAETVFVLGMRL 230
            .:....:.|  .||...|        :.:.|:.|.      .:|   ||:|.             
Human   213 PVEAGAAPMETQFPHVEARAASMETTEKLERILLQ------LLGDADQEKYT------------- 258

  Fly   231 NVTKNDIILFFG-KVGVIKMDES-------TNKPKIFVYKNKITGRSKGEATITYVSPFSAQAAI 287
                     ::| |.|.::..|:       |..|........:..:.....:.:|.||||:.:.|
Human   259 ---------YWGQKEGDLRSVETATSYFSGTTNPWSRASSEPLPVQLPASYSYSYSSPFSSFSDI 314

  Fly   288 SCLSGAKFMGQVITVLPAYLSTRRGSVRYSY-----PRELNAPEHQRRQR---AMKWKPAI---- 340
            ..:|..:  ..|...:|..|.:...:...|.     |..::..||.|.:|   ..:.:|.:    
Human   315 PTISPPQ--ATVTAPVPPQLPSDWEAFDTSLWSDGGPHRIDHQEHPRDRRYSEPHQQRPPVYRRP 377

  Fly   341 DNWVCMLCRNSNFVWRSSCNRC 362
            .:|.|..|...||..|.:|..|
Human   378 GDWDCPWCNAVNFSRRDTCFDC 399

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14718NP_650107.1 RRM <222..>335 CDD:223796 22/128 (17%)
RRM_SF 223..302 CDD:302621 14/86 (16%)
zf-RanBP 343..366 CDD:279035 8/20 (40%)
RanBP2-type Zn finger 343..362 CDD:275375 7/18 (39%)
zf-RanBP 397..423 CDD:295417
RanBP2-type Zn finger 398..417 CDD:275375
TEX13ANP_001278206.1 TEX13 5..144 CDD:317584 12/46 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 347..374 6/26 (23%)
zf-RanBP 376..400 CDD:279035 8/24 (33%)
RanBP2-type Zn finger 380..399 CDD:275375 7/18 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165152375
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.