DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14718 and taf15

DIOPT Version :9

Sequence 1:NP_650107.1 Gene:CG14718 / 41413 FlyBaseID:FBgn0037939 Length:446 Species:Drosophila melanogaster
Sequence 2:NP_001073442.1 Gene:taf15 / 558760 ZFINID:ZDB-GENE-061215-102 Length:434 Species:Danio rerio


Alignment Length:189 Identity:57/189 - (30%)
Similarity:83/189 - (43%) Gaps:52/189 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   222 TVFVLGMRLNVTKNDIILFFGKVGVIKMDESTNKPKIFVYKNKITGRSKGEATITYVSPFSAQAA 286
            |:||.|:..:|...::..:|.::|:||:::.|.||.|.:|.:|.|||.|||||:::..|.||:||
Zfish   209 TIFVQGLGEDVNAQEVGDYFKQIGIIKVNKKTGKPMINLYSDKATGRLKGEATVSFDDPPSAKAA 273

  Fly   287 ISCLSGAKFMGQVITVLPAYLSTRRGSVRYSYPRELNAPEHQRRQRAMKWK-------------- 337
            |....|.:|.|:.|.|   ..:|||.             |..:|......:              
Zfish   274 IDWFDGKEFNGRPIKV---SFATRRA-------------EFTQRGGGSGGRGGRGGFRGRGGGGG 322

  Fly   338 ----------PAID----NWVC--MLCRNSNFVWRSSCNRCQADKVVAPQNNEGSSWAG 380
                      |:.|    :|.|  ..|.|.||..|..||||...|      .||.|:.|
Zfish   323 GGGGGGFGGGPSFDVRGGDWPCPNSSCGNMNFARRYECNRCGTPK------PEGDSFGG 375

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14718NP_650107.1 RRM <222..>335 CDD:223796 39/112 (35%)
RRM_SF 223..302 CDD:302621 32/78 (41%)
zf-RanBP 343..366 CDD:279035 11/24 (46%)
RanBP2-type Zn finger 343..362 CDD:275375 9/20 (45%)
zf-RanBP 397..423 CDD:295417
RanBP2-type Zn finger 398..417 CDD:275375
taf15NP_001073442.1 RRM <209..>297 CDD:223796 37/103 (36%)
RRM_FUS_TAF15 209..291 CDD:240979 34/84 (40%)
zf-RanBP 338..368 CDD:279035 12/35 (34%)
RanBP2-type Zn finger 342..363 CDD:275376 9/20 (45%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1995
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1539664at2759
OrthoFinder 1 1.000 - - FOG0002238
OrthoInspector 1 1.000 - - otm25218
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23238
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5432
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
87.950

Return to query results.
Submit another query.