Sequence 1: | NP_650107.1 | Gene: | CG14718 / 41413 | FlyBaseID: | FBgn0037939 | Length: | 446 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001004806.1 | Gene: | taf15 / 448047 | XenbaseID: | XB-GENE-984011 | Length: | 501 | Species: | Xenopus tropicalis |
Alignment Length: | 226 | Identity: | 64/226 - (28%) |
---|---|---|---|
Similarity: | 92/226 - (40%) | Gaps: | 69/226 - (30%) |
- Green bases have known domain annotations that are detailed below.
Fly 222 TVFVLGMRLNVTKNDIILFFGKVGVIKMDESTNKPKIFVYKNKITGRSKGEATITYVSPFSAQAA 286
Fly 287 ISCLSGAKFMGQVITVLPAYLSTRRGSVRYSYPRELNAPEHQR---------------------- 329
Fly 330 -------RQRAMKWKPAIDNWVC--MLCRNSNFVWRSSCNRCQ-------------------ADK 366
Fly 367 VVAPQNNEGSSWA---GSREEDGAPRRWRPY 394 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG14718 | NP_650107.1 | RRM | <222..>335 | CDD:223796 | 43/141 (30%) |
RRM_SF | 223..302 | CDD:302621 | 34/78 (44%) | ||
zf-RanBP | 343..366 | CDD:279035 | 12/43 (28%) | ||
RanBP2-type Zn finger | 343..362 | CDD:275375 | 11/20 (55%) | ||
zf-RanBP | 397..423 | CDD:295417 | |||
RanBP2-type Zn finger | 398..417 | CDD:275375 | |||
taf15 | NP_001004806.1 | dnaA | 76..>220 | CDD:237605 | |
RRM_SF | 292..374 | CDD:388407 | 36/84 (43%) | ||
ZnF_RBZ | 424..450 | CDD:197784 | 12/25 (48%) | ||
RanBP2-type Zn finger | 426..447 | CDD:275376 | 11/20 (55%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1539664at2759 | |
OrthoFinder | 1 | 1.000 | - | - | FOG0002238 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR23238 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
4 | 4.110 |