DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14718 and taf15

DIOPT Version :9

Sequence 1:NP_650107.1 Gene:CG14718 / 41413 FlyBaseID:FBgn0037939 Length:446 Species:Drosophila melanogaster
Sequence 2:NP_001004806.1 Gene:taf15 / 448047 XenbaseID:XB-GENE-984011 Length:501 Species:Xenopus tropicalis


Alignment Length:226 Identity:64/226 - (28%)
Similarity:92/226 - (40%) Gaps:69/226 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   222 TVFVLGMRLNVTKNDIILFFGKVGVIKMDESTNKPKIFVYKNKITGRSKGEATITYVSPFSAQAA 286
            |:||.||..:.|::.|..:|.::|:||:::.|.||.|.:|.:|.||:||||||:::..|.||:||
 Frog   292 TIFVQGMGEDATQDQISDYFKQIGIIKINKKTGKPMINLYTDKETGKSKGEATVSFDDPPSAKAA 356

  Fly   287 ISCLSGAKFMGQVITVLPAYLSTRRGSVRYSYPRELNAPEHQR---------------------- 329
            |....|..|:..||.|   ..:|||             ||..|                      
 Frog   357 IEWFDGKMFLDNVIKV---SFATRR-------------PEFMRGGAGGGGGAGGGGGRRGGGHRG 405

  Fly   330 -------RQRAMKWKPAIDNWVC--MLCRNSNFVWRSSCNRCQ-------------------ADK 366
                   ..|.....|...:|||  ..|.|.||..|.|||:|.                   .|:
 Frog   406 GGFGGRGSYRGGGGGPQNGDWVCPNPSCGNVNFARRDSCNQCSEPRPEDSRHGGDRGRGGYGGDR 470

  Fly   367 VVAPQNNEGSSWA---GSREEDGAPRRWRPY 394
            ....:...|..:.   |.|.:..:.:|.|||
 Frog   471 GFRGRGRGGGGFGGKMGGRNDFRSDQRNRPY 501

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14718NP_650107.1 RRM <222..>335 CDD:223796 43/141 (30%)
RRM_SF 223..302 CDD:302621 34/78 (44%)
zf-RanBP 343..366 CDD:279035 12/43 (28%)
RanBP2-type Zn finger 343..362 CDD:275375 11/20 (55%)
zf-RanBP 397..423 CDD:295417
RanBP2-type Zn finger 398..417 CDD:275375
taf15NP_001004806.1 dnaA 76..>220 CDD:237605
RRM_SF 292..374 CDD:388407 36/84 (43%)
ZnF_RBZ 424..450 CDD:197784 12/25 (48%)
RanBP2-type Zn finger 426..447 CDD:275376 11/20 (55%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1539664at2759
OrthoFinder 1 1.000 - - FOG0002238
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23238
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.110

Return to query results.
Submit another query.