DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14718 and CG3732

DIOPT Version :9

Sequence 1:NP_650107.1 Gene:CG14718 / 41413 FlyBaseID:FBgn0037939 Length:446 Species:Drosophila melanogaster
Sequence 2:NP_611692.1 Gene:CG3732 / 37588 FlyBaseID:FBgn0034750 Length:282 Species:Drosophila melanogaster


Alignment Length:110 Identity:27/110 - (24%)
Similarity:46/110 - (41%) Gaps:25/110 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   342 NWVC--MLCRNSNFVWRSSCNRCQADKVVAPQ---------------NNEGSSWAGSREEDGA-- 387
            :|:|  ..||:.||..|..||:|..|:..:.:               .:..||.:.|:::.|.  
  Fly    23 DWICPDYDCRHLNFARRLQCNKCDRDRDGSDKPERDRDRDRERERGNGSSSSSSSSSKKKLGTEI 87

  Fly   388 ------PRRWRPYRNDWLCKICYNMNFWYRAKCNRCHALRSDEMK 426
                  ..|......||.|..|.|:|:..|..||.|:|.:..:::
  Fly    88 GKAAADKSRGLFSAEDWQCSKCANVNWARRQTCNMCNAPKFSDVE 132

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14718NP_650107.1 RRM <222..>335 CDD:223796
RRM_SF 223..302 CDD:302621
zf-RanBP 343..366 CDD:279035 10/24 (42%)
RanBP2-type Zn finger 343..362 CDD:275375 9/20 (45%)
zf-RanBP 397..423 CDD:295417 11/25 (44%)
RanBP2-type Zn finger 398..417 CDD:275375 8/18 (44%)
CG3732NP_611692.1 ZnF_RBZ 22..46 CDD:197784 9/22 (41%)
RanBP2-type Zn finger 24..45 CDD:275376 9/20 (45%)
zf-RanBP 100..129 CDD:279035 11/28 (39%)
RanBP2-type Zn finger 104..123 CDD:275376 8/18 (44%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1995
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.