DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14718 and caz

DIOPT Version :9

Sequence 1:NP_650107.1 Gene:CG14718 / 41413 FlyBaseID:FBgn0037939 Length:446 Species:Drosophila melanogaster
Sequence 2:NP_523365.2 Gene:caz / 32587 FlyBaseID:FBgn0285954 Length:399 Species:Drosophila melanogaster


Alignment Length:231 Identity:67/231 - (29%)
Similarity:87/231 - (37%) Gaps:91/231 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   212 GQEQYVIQAETVFVLGMRLNVTKNDIILFFGKVGVIKMDESTNKPKIFVYKNKITGRSKGEATIT 276
            |....:.|.:|:||.||..:.|:.||...||.:|:||.|:.|.||||::||||.||.||||||:|
  Fly   111 GGNDMITQEDTIFVSGMDPSTTEQDIETHFGAIGIIKKDKRTMKPKIWLYKNKETGASKGEATVT 175

  Fly   277 YVSPFSAQAAISCLSGAKFMGQVITVLPAYLSTRRGSVRYSYPRELNAPEHQRRQRAMKW----- 336
            |....:||:||....|..|.|..|.|..|                         ||...|     
  Fly   176 YDDTNAAQSAIEWFDGRDFNGNAIKVSLA-------------------------QRQNNWNKGGG 215

  Fly   337 ---------------------------------------------------------KPAIDNWV 344
                                                                     :|...:|.
  Fly   216 GGGGGGGRGGFGGRRGGGGGGGGGGGGGGRFDRGGGGGGGRYDRGGGGGGGGGGGNVQPRDGDWK 280

  Fly   345 CMLCRNSNFVWRSSCNRCQADKVVAPQNNEGSSWAG 380
            |..|.|:||.||:.||||:..|    .::||||..|
  Fly   281 CNSCNNTNFAWRNECNRCKTPK----GDDEGSSGGG 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14718NP_650107.1 RRM <222..>335 CDD:223796 45/112 (40%)
RRM_SF 223..302 CDD:302621 40/78 (51%)
zf-RanBP 343..366 CDD:279035 12/22 (55%)
RanBP2-type Zn finger 343..362 CDD:275375 10/18 (56%)
zf-RanBP 397..423 CDD:295417
RanBP2-type Zn finger 398..417 CDD:275375
cazNP_523365.2 RRM <118..>205 CDD:223796 44/111 (40%)
RRM_SARFH 122..204 CDD:240978 41/81 (51%)
zf-RanBP 275..304 CDD:279035 13/32 (41%)
RanBP2-type Zn finger 279..298 CDD:275375 10/18 (56%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 53 1.000 Domainoid score I7605
eggNOG 1 0.900 - - E1_KOG1995
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1539664at2759
OrthoFinder 1 1.000 - - FOG0002238
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23238
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.