Sequence 1: | NP_650107.1 | Gene: | CG14718 / 41413 | FlyBaseID: | FBgn0037939 | Length: | 446 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_523365.2 | Gene: | caz / 32587 | FlyBaseID: | FBgn0285954 | Length: | 399 | Species: | Drosophila melanogaster |
Alignment Length: | 231 | Identity: | 67/231 - (29%) |
---|---|---|---|
Similarity: | 87/231 - (37%) | Gaps: | 91/231 - (39%) |
- Green bases have known domain annotations that are detailed below.
Fly 212 GQEQYVIQAETVFVLGMRLNVTKNDIILFFGKVGVIKMDESTNKPKIFVYKNKITGRSKGEATIT 276
Fly 277 YVSPFSAQAAISCLSGAKFMGQVITVLPAYLSTRRGSVRYSYPRELNAPEHQRRQRAMKW----- 336
Fly 337 ---------------------------------------------------------KPAIDNWV 344
Fly 345 CMLCRNSNFVWRSSCNRCQADKVVAPQNNEGSSWAG 380 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG14718 | NP_650107.1 | RRM | <222..>335 | CDD:223796 | 45/112 (40%) |
RRM_SF | 223..302 | CDD:302621 | 40/78 (51%) | ||
zf-RanBP | 343..366 | CDD:279035 | 12/22 (55%) | ||
RanBP2-type Zn finger | 343..362 | CDD:275375 | 10/18 (56%) | ||
zf-RanBP | 397..423 | CDD:295417 | |||
RanBP2-type Zn finger | 398..417 | CDD:275375 | |||
caz | NP_523365.2 | RRM | <118..>205 | CDD:223796 | 44/111 (40%) |
RRM_SARFH | 122..204 | CDD:240978 | 41/81 (51%) | ||
zf-RanBP | 275..304 | CDD:279035 | 13/32 (41%) | ||
RanBP2-type Zn finger | 279..298 | CDD:275375 | 10/18 (56%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 1 | 1.000 | 53 | 1.000 | Domainoid score | I7605 |
eggNOG | 1 | 0.900 | - | - | E1_KOG1995 | |
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1539664at2759 | |
OrthoFinder | 1 | 1.000 | - | - | FOG0002238 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | P | PTHR23238 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
6 | 5.920 |