DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14718 and ewsr1b

DIOPT Version :9

Sequence 1:NP_650107.1 Gene:CG14718 / 41413 FlyBaseID:FBgn0037939 Length:446 Species:Drosophila melanogaster
Sequence 2:XP_005165164.2 Gene:ewsr1b / 322880 ZFINID:ZDB-GENE-030131-1600 Length:579 Species:Danio rerio


Alignment Length:467 Identity:103/467 - (22%)
Similarity:166/467 - (35%) Gaps:130/467 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 PQPQLQTQ-QQMFHANYIVGTT--------LGSGLGFNFAP----------APIPQASAASG--- 67
            |||...|| .|.:.|:...|:|        .||..|::..|          |..||:.:||.   
Zfish    93 PQPGAYTQPAQSYGASSYTGSTAAPAAQASYGSQPGYSTQPAYSGYSQQPAASAPQSYSASSQPA 157

  Fly    68 ------LSPRGMYSDLYR-YEDGSGDASGSLLLVQEDDHFCGAEADQQLVASTSSSCPMASSGES 125
                  ..|.|.....|: .:.|.|..       |:..:..|....|......::..|..||..:
Zfish   158 YNQSAYSQPAGYSQPGYQAQQPGYGQQ-------QQSAYGQGQPPQQHQQGPPAAYPPQGSSSYA 215

  Fly   126 VSIDTEQEA-ERDLQMNQCETLEREELNGDI----------------------------GEMGEM 161
            .:...:|.| :.|.|.|...:..:..::|..                            |.||  
Zfish   216 QTQYGQQSAPQNDYQQNPYNSYSQGGVSGGYPGSQRGGYQDGGRDGYDRGGPRGRGMGRGGMG-- 278

  Fly   162 EELAEEVNGEQRPPLLPCMGGNTSYMVFPRTAADYMPRLALPRHRPYISIGQEQYVIQAETVFVL 226
              :|.:..|..:|. .|..||....|..|                     |::.  .:..|:::.
Zfish   279 --IAGDRGGFNKPG-GPMRGGMDRDMGHP---------------------GEQD--SENSTIYIT 317

  Fly   227 GMRLNVTKNDIILFFGKVGVIKMDESTNKPKIFVYKNKITGRSKGEATITYVSPFSAQAAISCLS 291
            |:..|.|..::..||...|.|:::...|:|.|.:|.:|.:|:.||:||::|..|..|:||:....
Zfish   318 GLTENATLPEMAEFFKHTGAIRINRRLNQPAINIYTDKDSGKPKGDATLSYEEPAFAKAAVEHFD 382

  Fly   292 GAKFMGQVITVLPAYLSTRRGSVRYSYPRELNAPEHQRRQRAMKWKPAIDNWVCMLCR---NSNF 353
            |.:|.|:.:.|..|......|.:|...|              |:..|.:|.. .|:.|   ...|
Zfish   383 GKEFQGRRLKVSMARRKPMIGGMRGGMP--------------MRGGPGMDRG-GMMGRGGERGGF 432

  Fly   354 VWRSSCNRCQADKVVAPQNNEGSSWAGSREEDGAPRRWRPYRNDWLCKI--CYNMNFWYRAKCNR 416
            ..|.           .|:.  |..|.|..:.....:|    ..||.|..  |.|.||.:|.:||:
Zfish   433 PPRG-----------GPRG--GMGWNGGPQPGNVQKR----AGDWECPNAGCGNQNFSWRMECNQ 480

  Fly   417 CHALRSDEMKSS 428
            |.|.:.:.:.:|
Zfish   481 CKAPKPEGLGTS 492

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14718NP_650107.1 RRM <222..>335 CDD:223796 31/112 (28%)
RRM_SF 223..302 CDD:302621 25/78 (32%)
zf-RanBP 343..366 CDD:279035 4/25 (16%)
RanBP2-type Zn finger 343..362 CDD:275375 4/21 (19%)
zf-RanBP 397..423 CDD:295417 12/27 (44%)
RanBP2-type Zn finger 398..417 CDD:275375 9/20 (45%)
ewsr1bXP_005165164.2 RRM <306..>397 CDD:223796 27/92 (29%)
RRM_SF 312..395 CDD:302621 27/82 (33%)
zf-RanBP 456..486 CDD:279035 13/33 (39%)
RanBP2-type Zn finger 460..481 CDD:275375 9/20 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1995
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1539664at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm25218
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23238
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
65.880

Return to query results.
Submit another query.